Разное

Гв и герпес: герпес при гв — 25 рекомендаций на Babyblog.ru

Содержание

герпес при гв — 25 рекомендаций на Babyblog.ru

Недавно писала пост о том, что моя годовалая дочь подхватила герпес, а вскоре успешно перенесла его мне на соски (мы на ГВ). Язвочки были не только у нее на губе, но и в горле, на языке и деснах, т.е. была еще и герпесная ангина и стоматит. Ребенок постоянно плакал, почти ничего не ел и не пил, просил грудь, а я каждое кормление умирала от боли.

Наш педиатр прописала виферон, йодинол и мираместин. На мой вопрос, что же делать с грудью, ведь ребенку надо что-то кушать и пить, пожала плечами и посоветовала прекращать кормить. Я спросила, можно ли дать дочке курс ацикловира внутрь, и мне ответили, что нет, он с трех лет.

Ну ОК, делать нечего, все купила, пришла домой и стала читать инструкции к препаратам. И оказалось, что мираместин, блин, тоже с трех лет! Нет, ну что за двойные стандарты?!

Один день я полечила дочь по рецепту педиатра, и к вечеру у нее вылез еще и на шее герпес :((

Короче, плюнула я, и купила таблетки и себе, и дочке. Сама пила по таблетке пять раз в день, дочке давала по половинке четыре раза (больше не получалось, т.к. дочкин день длится 12 часов, а интервал должен быть 4 часа, 5 раз никак не получалось). Курс 5 дней. Мазала себе соски между кормлениями и дочке губу и шею мазью ацикловир, но у дочки он был малоэффективен, т.к она все быстро стирала.

Уже на следующий день были заметные улучшения. Дочка стала кушать, пить водичку, стала менее капризной. На шее пузырьки изчезли совсем. Грудь моя тоже зажила быстро, на второй день и следа не осталось. Дочка была в норме уже на третий день приема препарата, бодра и весела, даже язвочки на губе подсохли и по одной отваливались, но мы все равно пропили курс до конца. Мираместин и йодинол тоже брызгала какое-то время, наверное, тоже был обеззараживающий эффект.

Побочек от таблеток не заметила ни на себе, ни на дочке.

В общем, в очередной раз сделала вывод, что наши врачи работают на выгоду аптек. Виферон и мираместин вышли у меня на 500 р, в то время как две упаковки ацикловира и мазь — 150. Вот такие дела. Может быть, кому-то будет полезен наш опыт.

Герпес при грудном вскармливании, что делать? — Вірус Стоп

Женский организм наиболее уязвим перед различными вирусными инфекциями, в том числе и перед герпесом. Вирусная инфекция в организме у женщины провоцирует различные проблемы со стороны половой сферы. Речь идет о воспалительных заболеваниях женских половых органов, возможное бесплодие, самопроизвольные аборты и т.д. Герпес при частом рецидивирующем течении способен значительно угнетать защитные иммунные силы организма, снижать работоспособность, ухудшать качество жизни.

Куда опасней, если симптомы вируса герпеса появился у женщины в период грудного вскармливания. Важно вовремя обратиться к врачу за адекватным лечением герпеса. Стоит помнить, что герпес у матери может стать предпосылкой для появления данной проблемы и у малыша, спровоцировать развитие герпетиформной экземы Капоши, герпетической ангины. В таком случае проводить лечение герпеса у детей крайне тяжело.

Зачастую, именно в детском возрасте малыш впервые знакомится с таким распространенным видом герпесвирусной инфекции, как вирус простого герпеса. Увеличивает риск появления симптомов герпеса у малыша  тесный контакт  с человеком с острыми проявлениями герпеса. 

Нередки случаи проявления у матери такой вирусной инфекции, как опоясывающий герпес. Инфицирование малыша герпес зостер в свою очередь может спровоцировать у него тяжелую форму течения ветряной  оспы. 

Серьезные последствия для малыша может иметь острая форма генитального герпеса у матери.

 

Как же обезопасить малыша от опасного вируса?

Минимизировать риск инфицирования малыша герпесвирусной инфекцией возможно, следуя ряду рекомендаций. Во-первых, при возникновении элементов герпеса на коже, матери важно обратиться к врачу за помощью. Во-вторых, не стоит пренебрегать гигиеническим  рекомендациям. На период появления острых симптомов следует ограничить тесный контакт с малышом, не допускать контакт ребенка с пораженной областью кожи матери (пузырьки, эрозии, корочки).

 

Как сохранить грудное вскармливание?

В целом, при простом герпесе 1 типа, а также при легкой форме опоясывающего  герпеса у матери, прекращать грудное вскармливание не стоит. Дело все в том, что герпес не поражает протоки молочных желез, в том числе не передается малышу через молоко. За редким исключением, если элементы герпеса расположены в области кожи груди, соска, в таком случае к этой груди малыша прикладывать не стоит. Постарайтесь сцеживать молоко. Рекомендовано кормить малыша из груди, чистой от высыпаний вирусной природы.

Угрозой полного прекращения грудного вскармливания может являться факт появления острой формы генитального герпеса, а также средне-тяжелой формы течения опоясывающего герпеса. Лечение данных вирусных инфекций сопряжено с применением не только местных противовирусных препаратов, но и лекарственных средств для внутреннего применения. В свою очередь, системная противовирусная терапия не рекомендована в период кормления грудью.

На период лечения, с целью сохранения грудного вскармливания, матери следует активно проводить сцеживание. Малыша рекомендовано перевести на искусственное вскармливание. После применения курса терапии естественное вскармливание можно возобновить.

 

Как не допустить обострения герпеса у матери?

Обострение герпеса  появляется не на пустом месте. Одним из провоцирующих факторов, является ослабление защитных иммунных сил организма. Как правило, ослабление иммунитета наблюдается в результате перенесенных заболеваний, в том числе и инфекционных: ОРЗ, грипп. Не стоит недооценивать влияние таких факторов, как переутомление, недосыпание, стресс.

Следовательно, не допустить обострений герпеса можно благодаря рациональному питанию, полноценному сну, прогулкам на свежем воздухе, благоприятной эмоциональной атмосфере и т.п. В зимний период важно не забывать о мерах профилактики ОРЗ, гриппа (обработка слизистой входа в носовые пазухи оксолиновой мазью, ограничение пребывания в местах скопления людей). Напротив, в летний период, риск обострения герпеса может возникнуть при перегревании, при длительном пребывании на солнце. 

Как провести профилактику обострений герпеса на губах

Мать с генитальным герпесом: можно ли кормить грудью

Генитальный герпес при грудном вскармливании не является противопоказанием. Более того, вместе с молоком ребенок получит защитные антитела.

Однако в этот период следует быть очень осторожной, поскольку существует высокий риск заражения малыша. И только в некоторых случаях рекомендуется прекратить ГВ на время лечения.

В этой статье Вы узнаете:

Симптомы

Герпес у кормящей мамы может появиться на любом участке тела. В зависимости от вида патологии выделяют следующие симптомы:

  1. Первый тип герпеса. Чаще всего высыпания появляются на губах, но могут быть локализованы на щеках или на носу. Первые симптомы заболевания характеризуются появлением зуда и жжения в той области, где через несколько часов появятся прыщики. Постепенно они будут увеличиваться в размере и сливаться между собой. Волдыри заполнены жидкостью, в которой содержится «концентрат» вируса. Когда пузырьки лопаются, на их месте образуются мокнущие язвочки. По мере их подсыхания формируется корочка, которая сходит самостоятельно.
  2. Генитальный герпес, или 2 тип. У женщин краснеет кожа в области вульвы, промежности, ануса и влагалища. Гиперемированная слизистая отекает. Все это сопровождается сильным зудом. Дополнительно герпес у кормящей мамы может спровоцировать учащенное мочеиспускание, тяжесть в животе (внизу), головную боль, повышенную раздражительность, тошноту или температуру. Пораженная область покрывается везикулами, которые заполнены мутной жидкостью. Когда прыщи лопаются, на их месте появляются язвочки. Они покрываются желтым гнойным налетом (подробнее читайте тут).
  3. Опоясывающий герпес (3 тип). Изначально женщина испытывает общие признаки недомогания. По окончании продморального периода появляется ощущение зуда и жжения по направлению периферических нервов. На этом участке тела вскоре сформируется сыпь. Прыщи не сливаются между собой. Изнутри они заполнены серозной жидкостью. Высыпания локализуются по ходу спинных нервных ганглиев. Двустороннее поражение встречается редко.

Как не допустить инфицирования крохи

После рождения ребенка организм женщины испытывает повышенные нагрузки, в результате чего иммунная система значительно ослабевает. Поэтому очень часто именно в этот важный период обостряются многие недуги, особенно половой герпес. Это может быть первый эпизод или рецидив заболевания.

Генитальный герпес характеризуется возникновением высыпаний на наружных и внутренних половых органах. В этих пузырьках содержится активный вирус. Поэтому женщина должна принять все возможные меры, чтобы не допустить его распространения и защитить ребенка. Для этого нужно строго придерживаться определенных правил:

  1. Кормление грудью во время генитального герпеса не нужно прекращать. Ведь ребенок не контактирует с высыпаниями, поэтому нет прямого риска для его заражения. Исключение составляет только тот вариант, когда герпетические пузырьки появляются на сосках. Поэтому категорически запрещено кормить малыша больной грудью. Вторую молочную железу можно давать, но строго следить за тем, чтобы ребенок не дотрагивался до больной.
  2. Соблюдение правил личной гигиены. Ни в коем случае нельзя допустить контакта крохи с высыпаниями. После проведения водных процедур или обработки кожи и слизистых оболочек женщина должна обязательно хорошо вымыть руки с мылом. Ведь при этом существует высокий риск повреждения пузырьков и попадания вируса на кожу. Если в доме находится младенец, необходимо мыть руки каждый раз перед тем, как подойти к малышу, поменять подгузник, покормить и т. д. Это нехитрое правило позволит минимизировать риск инфицирования.
  3. Для гигиенических процедур использовать специально выделенные для этой цели полотенца и другие аксессуары.

Чем опасен герпес для ребенка

Вирус герпеса, как простого, так и опоясывающего, проникает в организм человек в детском или юношеском возрасте. Остается он на всю жизнь, «живет» в клетках периферических нервов. При нормальном состоянии иммунитет клинических проявлений болезни нет. Если по тем или иным причинам иммунная система ослабевает, происходит обострение. У многих женщин они возникают через довольно короткие промежутки времени, что создает проблемы при кормлении грудью.

Опасен ли герпес малышу во время лактации? Заражение вирусом происходит при непосредственном контакте с пораженными участками кожи. Если ребенок не контактирует с ними, заражение не произойдет. Кроме того, в грудном молоке мамы в период обострения есть много защитных антител. Они попадают в организм малыша, создают дополнительную защиту. В первую очередь это касается опоясывающего герпеса. Ведь тот же самый вирус вызывает у детей ветрянку.

Правильное грудное вскармливание ребенка при герпесе

Единственный случай, когда герпес действительно опасен для грудных детей, — его локализация на сосках. Тогда вероятность заражения действительно высокая и стоит вопрос о совместимости герпеса и кормления грудью. Врачи рекомендуют временно его прекратить, пока не закончится лечение, и не пройдут высыпания.

Герпетическая инфекция у детей протекает гораздо тяжелее, чем у взрослых. При заражении герпесом первого типа во рту возникают болезненные афты, повышается температура, ребенок отказывается от еды. Ветряная оспа у грудных детей сопровождается генерализированными высыпаниями, тяжелым состоянием организма, лихорадкой. К счастью, антитела матери защищают грудничков и заражение происходит редко, если придерживаться всех правил профилактики.

Можно ли кормить грудью при герпесе?

Кормление грудью считается профилактикой заражения ребёнка. Если женщина заражена инфекцией, во время кормления грудью, активируется выработка специфических антител, угнетающих активность герпеса. Для блокирования обострения требуется 3-4 дня. Вырабатываемые антитела проникают в грудное молоко и передаются малышу, препятствуя тем самым инфицированию ребёнка — антитела формируют иммунитет против инфекции.

Если ребёнок не контактирует с воспалённой тканью, риски заражения не больше 0,1%. Но при этом важно соблюдать строгие правила, которые оградят младенца от заражения.

Правила кормления

  1. Исключить контакт малыша с заражённой тканью.
  2. Обрабатывать руки антисептическим средством перед каждым кормлением.
  3. Не прерывать курс лечения раньше назначенного врачом срока.

Приостанавливать грудное вскармливание рекомендуется только в случаях высыпаний герпеса в сосковой зоне. При этом, если поражена одна железа, для кормления используется только здоровая. При поражении любого другого участка тела ГВ продолжается.

Меры предосторожности

Хипес у мамы и кормление грудью совместимы. Но женщинам следует принимать меры предосторожности, чтобы младенец не заразился вирусом. Как мама сможет защитить ребенка от инфицирования?

Для этого ей надо избегать прямых контактов пораженных участков с нежной, восприимчивой кожей малыша, во время кормления надевать марлевую повязку и строго соблюдать правила личной гигиены.

Как укрепляют иммунитет?

Нужно понимать, что при вирусных инфекциях мы принимаем лекарства, подавляющие размножение вируса, но основную роль играет все же состояние иммунитета больного. Иммунные клетки выделяют антитела, которые уничтожают вирусы и не дают им распространяться в организме. Поэтому поддержка наших защитных сил – не менее важный пункт лечения, чем прием противовирусных препаратов.

Если генитальный герпес обострился при ГВ, молодой маме нужно следить, чтобы ее питание было богато белками, ведь именно из них иммунные клетки производят антитела. Если женщина строго ограничила свой рацион и, например, ест только гречку и яблоки, сложно ожидать от ее иммунной системы эффективной защиты. Напомним, что чаще всего строгая диета при грудном вскармливании не нужна.

Не менее важно хорошо высыпаться и отдыхать. Кормящие мамы часто воспринимают этот совет как невыполнимое условие. Но, может быть, постараться объяснить близким,что если женщина попадет в больницу, легче от этого не станет никому, и лучше сейчас помочь ей и дать время отдохнуть, чем потом остаться дома один на один с грудным ребенком.

Иногда для лечения герпеса используют иммуномодулирующие препараты (например, свечи «Кипферон», «Виферон»), но самим себе назначать лекарства этой группы нельзя. Не все из них совместимы с ГВ, а кроме того, их невдумчивое применение может повлиять на иммунитет самым непредсказуемым образом.

Диагностика генитального герпеса у кормящей мамы

Для постановки диагноза кормящей маме следует обратиться к врачу. Специалист сможет диагностировать генитальный герпес при первичном осмотре. Для определения точного диагноза пациентка направляется на лабораторные исследования.

Чтобы выявить тип возбудителя недуга берётся мазок с поражённого места, после чего проводится посев. Но бак-посев не всегда является информативным исследованием: результаты анализа могут быть ложноотрицательными. Поэтому рекомендуется проводить это исследование через несколько суток после появления признаков генитального герпеса у кормящей мамы.

При рецидивирующей форме выявить возбудителя удаётся с вероятностью не более 30%. Ещё одним способом для постановки диагноза является метод цепной реакции. Для его проведения необходим образец материала поражённого места. Наиболее достоверным методом определения наличия вируса в организме кормящей мамы являются анализы крови.

Проводится иммуноферментный анализ, в ходе которого можно изучить уровень антител в организме кормящей мамы. Иммуноферментный анализ может быть количественным, что позволяет выявить уровень антител. Если обнаружено большое количество антител, это говорит о недавнем рецидиве генитального герпеса. Качественный иммуноферментный анализ направлен на изучение типа вируса.

Лечение заболевания при лактации

Возникновение признаков генитального герпеса требует немедленного обращения за медицинской помощью. Это необходимо для того, чтобы убедиться в диагнозе, особенно если это впервые возникший эпизод. Ведь существует много разновидностей инфекционных и других недугов, сопровождающихся появлением сыпи в области половых органов.

Кроме того, герпесвирусная инфекция сопровождается возникновением боли, зуда, отека тканей, слизистых оболочек и других неприятных ощущений, которые приводят к значительному ухудшению самочувствия. В некоторых случаях возможно появление озноба, сильной слабости, сонливости, ломоты в костях и мышцах, повышения температуры тела. Это грозит уменьшением количества вырабатываемого молока и даже успешному ГВ.

При герпесе назначить лечение может только врач. Ведь основная масса фармакологических препаратов категорически запрещена к применению во время лактации. Это связано с тем, что противовирусные компоненты способны проникать в грудное молоко и воздействовать таким образом на малыша.

На основании осмотра пациентки врач разрабатывает индивидуальную схему лечения. В зависимости от степени выраженности клинических проявлений, особенно если это впервые возникшая генитальная герпесвирусная инфекция, может быть принято решение о необходимости временного прекращения ГВ.

Ведь при этом требуется мощная противовирусная и иммуномодулирующая терапия, которая абсолютно не совместима с грудным вскармливанием. На это время ребенка необходимо перевести на искусственные смеси. После окончания курса лечения лактацию можно возобновить, особенно если во время приема медикаментозных препаратов молодая мама регулярно сцеживалась, чтобы организм постоянно вырабатывал молоко.

При возникновении рецидива, особенно если кроме появления высыпаний отсутствуют какие-либо другие симптомы герпесвирусной инфекции, возможно применение местного лечения. В этом случае женщина может смело продолжать грудное вскармливание. Опытный врач подберет препараты, которые действуют только в месте нанесения и не проникают в системный кровоток.

С их помощью можно снизить проявления заболевания, не допустить дальнейшего распространения сыпи, блокировать размножение вируса в пузырьках и облегчить клинические проявления. Противовирусные мази или кремы сократят период высыпаний и ускорят выздоровления больной. Кормящие женщины могут смело использовать препараты на основе ацикловира и др. Подобрать необходимый и расписать схему лечения поможет врач.

Как правило, противовирусные мази нужно наносить на область высыпаний до 4–5 раз в сутки. Обработку следует делать только после проведения гигиенических процедур, а средство желательно наносить с помощью перчаток или специального напальчника. Если манипуляция проводилась руками, после этого их нужно хорошо вымыть с мылом.

Как лечат генитальный герпес, который остался после родов

Если после родов проявился генитальный герпес, то его лечение осуществляется местными препаратами: Зовиракс, Ацикловир и пр., которыми смазывается стенка влагалища. Применять данные препараты следует 3 раза в день.

Кроме этого, нужно следить за своим питанием, употреблять витамины и поддерживать иммунитет. Если болезнь не лечить, к ней может присоединиться еще одна генитальная инфекция. В это время нужно воздержаться от половой близости с партнером, так как вирус может легко ему передаться.

Жизнь после родов — KP.Ru

Кормящей маме всегда необходима поддержка близких и особое внимание врачейФото: EAST NEWS

Беременность и роды остались позади. Встреча с долгожданным комочком счастья произошла, жизнь перевернулась, и теперь мама полностью поглощена малышом.

Кормление грудью, недосыпание, утомление, переживание за малютку, пониженный уровень гемоглобина — все это приводит к снижению иммунитета и обострению многих хронических заболеваний. Скрытые инфекции, проблемы ЖКТ, которые до этого протекали в латентной форме, часто обостряются именно во время лактации. Ослабленный организм не в силах бороться даже с самой незначительной инфекцией, поэтому кормящей маме всегда необходима поддержка близких и особое внимание врачей.

Как вылечить герпес у кормящей мамы?

Одной из частых жалоб в раннем послеродовом периоде является активация герпеса, как лабиального, так и генитального. К сожалению, выбор препаратов для лечения герпеса у кормящей мамы весьма ограничен. Но есть совершенно безопасное средство, которое может применяться как во время беременности, так и во время лактации. Это мазь ВИФЕРОН®, которая применяется для лечения ОРВИ и герпеса различной локализации. Интерферон, входящий в состав препарата блокирует размножение вируса, а наличие витамина Е обеспечивает ранозаживляющее действие. ВИФЕРОН Мазь корректирует показатели местного иммунитета, позволяя справляться с симптомами заболевания и реже болеть в дальнейшем. Ингредиенты препарата, проникая в кожу, оказывают иммуномодулирующее действие и позволяют предотвратить размножение вируса. Разрешен детям с 1 года, беременным и кормящим женщинам.

Причины появления трещин сосков и их устранение

Очень часто первые месяцы кормления грудью молодая мама сталкивается с трещинами сосков. Десенки новорожденных довольно сильные, и даже не имея зубов, малыши способны травмировать соски. При попадании инфекции на фоне сниженного иммунитета запускается воспалительный процесс. Трещины сосков причиняют боль, могут привести к развитию мастита. Самая частая ошибка в таких случаях — это прекращение грудного вскармливания. Никто не станет отрицать, что мамино молоко является незаменимой едой для малыша, особенно в самые первые месяцы. Существует много способов предотвратить возникновение трещин сосков, а также от них избавиться. Еще в роддоме всех молодых мам обучают, как правильно прикладывать ребенка к груди, как долго его кормить, как понять, наелся малыш или нет, как заставить его отпустить сосок. Новорожденные довольно быстро наедаются, так как им требуется совсем немного молока, но часто засыпают с соском во рту и не желают его выпускать. Это одна из причин появления трещин. Еще кормящая мама должна сразу усвоить, как правильно малыш должен захватывать грудь. Если он захватывает только сосок, это также приведет к мацерации и трещинам. Материнское молоко обладает ценными питательными веществами и сильным иммунитетом. Поэтому его можно использовать в качестве профилактики образования трещин. Стоит лишь нанести каплю молока вокруг соска после кормления. При первых же симптомах трещин необходимо начать лечение, которое должен рекомендовать врач на очном приеме. Терапия может включать репаративные средства на основе декспантенола, иммунокорректоры, такие как мазь ВИФЕРОН®, для восстановления и поддержания местных защитных свойств кожи, масла с противовоспалительным действием, например, облепиховое масло.

.

Ребенок – не повод забывать о себе

Необходимо помнить, что в зимний период, когда резко возрастает риск заражения вирусными инфекциями (грипп, ОРВИ), кормящей маме следует позаботиться не только о своем малыше, но и о себе. Посещение детской поликлиники, супермаркетов, детских садов, если в семье есть старший ребенок, прогулки по свежему воздуху, общение с близкими людьми- все это может привести к передаче вирусов. Чтобы не ограничивать свой привычный распорядок жизни и не подвергать себя и малыша инфицированию, надо следовать простым правилам. В разгар эпидемии чаще проветривать комнаты, избегать мест скопления народа, не допускать контакта с уже болеющими людьми, применять профилактические препараты, безопасные для малыша. В этом плане незаменим гель ВИФЕРОН®. Его следует наносить на слизистую носа маме и малышу. Не стоит забывать о санации носовой полости при помощи раствором на основе морской воды. Мамино молоко надежно обеспечивает кроху иммунитетом, который защищает его от инфицирования. А вот самой маме следует надевать маску при посещении публичных мест и почаще ее менять. Не стоит впадать в крайности: приобретать кварцевые лампы для дезинфекции помещения и обрабатывать помещение антисептиками. Достаточно проводить ежедневную влажную уборку, проветривать квартиру и изолировать малыша от больных членов семьи.

Имеются противопоказания. Необходима консультация специалиста.

Ацикловир для беременных и кормящих грудью: можно ли принимать. Лекарства при беременности и грудном вскармливании: ответы врачей

Можно ли ацикловир при беременности для лечения герпеса и возможные риски для плода


Ацикловир относится к классу антивирусных препаратов, называемых синтетическими аналогами нуклеозидов. Он работает, останавливая распространение вируса герпеса в организме. Используется для уменьшения боли и ускорения заживления язв или волдырей у людей с ветряной оспой (ветрянка), опоясывающим лишаем, сыпью, которая может возникать у людей, перенесших ветряную оспу в прошлом, а также при вспышках генитального герпеса (время от времени вызывает образование язв вокруг гениталий и прямой кишки).


В результате исследования Центром по контролю и профилактики заболеваний (CDC), было установлено, что ацикловир проникает через плаценту, однако тератогенность (развитие врожденных пороков) не наблюдалась, но все же данных недостаточно для оценки риска менее распространенных дефектов или для получения надежных или окончательных выводов относительно безопасности этого препарата во время беременности.


По исследованиям Управления по санитарному надзору за качеством пищевых продуктов и медикаментов (FDA) было отмечено, что женщины, принимающие ацикловир для лечения простого герпеса даже в период первого триместра беременности, не продемонстрировало риск для плода.


Австралийская администрация лекарственных средств (AU TGA) исследовала ограниченное количество беременных женщин и женщин детородного возраста, которые принимали пероральный ацикловир и установили, что это не привело к увеличению частоты пороков развития или других прямых или косвенных вредных воздействий на материнский плод. Исследования на животных показали увеличение частоты повреждений плода, значение которых для человека считается неопределенным.


Американский колледж акушеров и гинекологов (ACOG) рекомендует принимать ацикловир для лечения генитального герпеса, особенно рецидивирующего, с 36-ой недели беременности для избежания заражения новорожденного младенца. Но поскольку в результате не множественных исследований о нем мало предоставлено информации, то и применять его советуют с особой осторожностью, строго по назначению врача в точно указанной минимальной дозировке в кратчайшие сроки.


Также ACOG была предоставлена информация о том, что супрессивная терапия на поздних сроках беременности снижает частоту кесарева сечения у женщин с рецидивирующим генитальным герпесом за счет уменьшения частоты рецидивов во время беременности, но такое лечение не во всех случаях может защитить от передачи вирусной инфекции новорожденным.


Центр по контролю и профилактике заболеваний (CDC) в 2015 году пришли к выводу, что этот препарат можно использовать для лечения герпетических поражений у женщин на всех этапах беременности, но под четким контролем врача, соблюдая все его предписания по прописанным дозам, частоте и длительности приема, а также в случае самой острой необходимости и, как правило, польза для матери должна превышать риск для плода.

Применение ацикловира при кормлении грудью и воздействие на младенцев


Управление по санитарному надзору за качеством пищевых продуктов и медикаментов (FDA) в результате исследований применения ацикловира у женщин в период грудного вскармливания установили, что он проникает в грудное молоко, но даже при самых высоких дозах для матери концентрация ацикловира в молоке составляет лишь около 1% от типичной детской дозы, и не ожидается, что она вызовет какие-либо побочные эффекты у младенцев, находящихся на грудном вскармливании. Местное нанесение ацикловира на небольшие участки тела матери вдали от груди не представляют опасности для младенца.


В результате заражения вирусом герпеса младенца от матери во время беременности новорожденным вводят ацикловир в дозах от 20 до 30 мг/кг внутривенно ежедневно по данным CDC. Дозировки, полученные с грудным молоком при высоких дозах для матери, составляют всего около 3-5% от этой дозы. Поскольку младенец получает дозы грудного молока перорально, а ацикловир перорально биодоступен только около 20%, системная доза, которую получает грудной младенец, составляет 1% или меньше от типичной детской дозы, в результате чего не были зафиксированы проявления побочных реакций у младенцев.


Также CDC и FDA  были зарегистрированы несколько случаев по поводу приема перорального ацикловира у матерей кормящих грудью:


  • мать 4-месячного младенца не заметила никаких побочных эффектов у своего младенца, находящегося на грудном вскармливании, когда она принимала ацикловир в дозе 800 мг перорально 5 раз в день;


  • женщина, которой было 6 недель после родов, получала ацикловир 300 мг (5 мг/кг) внутривенно три раза в день в течение 5 дней. Образцы молока брали каждые 6 часов после последней дозы. Пиковый уровень составлял 7,3 мг/л, и препарат обнаруживался в молоке в течение 88 часов после последней дозы. Через 6 часов после приема последней дозы, вскармливаемый грудью ребенок получал через материнское молоко суточную дозу 1,1 мг/кг ацикловира, в случае такой терапии у матери в период лактации, также не отмечались негативные последствия у младенца.


В результате таких исследований Центр по контролю и профилактике заболеваний (CDC) и Управление по санитарному надзору за качеством пищевых продуктов и медикаментов (FDA), пришли к выводу, что прием ацикловира для женщин в период лактации, считается приемлемым, но не должен приниматься бесконтрольно, дозу и длительность лечения ацикловиром должен устанавливать врач, с обязательным сопоставлением пользы для матери и возможных рисков для новорожденного.

Герпес при грудном вскармливании — Вопрос педиатру

Если вы не нашли нужной информации среди ответов на этот вопрос, или же ваша проблема немного отличается от представленной, попробуйте задать дополнительный вопрос врачу на этой же странице, если он будет по теме основного вопроса. Вы также можете задать новый вопрос, и через некоторое время наши врачи на него ответят. Это бесплатно. Также можете поискать нужную информацию в похожих вопросах на этой странице или через страницу поиска по сайту. Мы будем очень благодарны, если Вы порекомендуете нас своим друзьям в социальных сетях.

Медпортал 03online.com осуществляет медконсультации в режиме переписки с врачами на сайте. Здесь вы получаете ответы от реальных практикующих специалистов в своей области. В настоящий момент на сайте можно получить консультацию по 71 направлению: специалиста COVID-19, аллерголога, анестезиолога-реаниматолога, венеролога, гастроэнтеролога, гематолога, генетика, гепатолога, гериатра, гинеколога, гинеколога-эндокринолога, гомеопата, дерматолога, детского гастроэнтеролога, детского гинеколога, детского дерматолога, детского инфекциониста, детского кардиолога, детского лора, детского невролога, детского нефролога, детского офтальмолога, детского психолога, детского пульмонолога, детского ревматолога, детского уролога, детского хирурга, детского эндокринолога, дефектолога, диетолога, иммунолога, инфекциониста, кардиолога, клинического психолога, косметолога, логопеда, лора, маммолога, медицинского юриста, нарколога, невропатолога, нейрохирурга, неонатолога, нефролога, нутрициолога, онколога, онкоуролога, ортопеда-травматолога, офтальмолога, паразитолога, педиатра, пластического хирурга, проктолога, психиатра, психолога, пульмонолога, ревматолога, рентгенолога, репродуктолога, сексолога-андролога, стоматолога, трихолога, уролога, фармацевта, физиотерапевта, фитотерапевта, флеболога, фтизиатра, хирурга, эндокринолога.

Мы отвечаем на 97.5% вопросов.

Оставайтесь с нами и будьте здоровы!

Грудное вскармливание: как замечательно все создано природой!



Грудное вскармливание: как замечательно все создано природой! | СПб ГБУЗ «Городская поликлиника №122»

4

Фев


2016

Материнское молоко является питанием для Вашего ребенка, отвечающим всем потребностям младенца на первом году жизни. Оно дает ребенку то, в чем он нуждается, причем в нужный момент и в нужной пропорции. Материнское молоко содержит все питательные вещества, необходимые для роста и развития ребенка. Во время первого кормления у женщины вместо молока вырабатывается молозиво – желтовато-оранжевая густая жидкость. Молозиво, а впоследствии молоко, содержит все элементы, которые укрепляет иммунитет Вашего младенца для сопротивления организма различным болезням. И действительно, многочисленные исследования показывают, что дети, вскормленные грудью, гораздо меньше подвержены, либо легче переносят диарею, респираторные инфекции, отит и прочие инфекции, часто встречающиеся у младенцев.
Помимо того, что материнское молоко защищает еще неразвитую иммунную систему ребенка, оно еще и подготавливает организм к последующему введению в организм новых продуктов. В любом случае, младенец принимает и переваривает материнское молоко гораздо лучше, чем любое другое детское питание; из материнского молока ребенок усваивает 96% веществ, а из детского питания только 86%. Время, в течение которого материнское молоко переваривается, составляет в среднем полтора часа, любое другое молоко в два раза дольше.

 

Нужно ли кормить ребенка грудью?

Для многих ответ очевиден, но некоторые мамы задаются вопросом выбора способа кормления.
В течение многих недель и месяцев Вы будете получать множество советов и информации от врача, мудрой мамы или подруг, и со временем Вы определились в своем выборе.
Материнское молоко наилучшим образом подходит Вашему ребенку. Однако, если Вы не можете кормить грудью, питание с помощью бутылочки с соской содержит на сегодняшний день все необходимые основные питательные вещества для обеспечения нормального роста ребенка.

 

Для Вас, мама

Кроме практической пользы кормления грудью, позволяющей избежать различных приготовлений к кормлению из бутылочки, требующих времени и средств, польза заключается еще и в том, что кормление грудью позволит вам быстрее восстановиться после родов. Сосание младенцем груди вызывает легкое сокращение матки. Вы этого не чувствуете, но такие сокращения способствуют более быстрому восстановлению после родов.

 

Для вас обоих

Пока Вы сами не станете мамой, «образ матери и ребенка» является только красивой картинкой. Но жить в постоянном контакте с ребенком, обрести физическую близость, которая объединяла вас до его рождения, продолжать давать ему жизнь – это не так легко, как кажется. Нужно много терпения и усилий. Младенец чувствует запах и теплоту матери, ее ласку и ощущает себя в безопасности. В такие моменты зарождается особая эмоциональная связь.

 

 

Грудное вскармливание полезно ребенку

Грудное вскармливание является не имеющим себе равных способом обеспечения идеальным питанием грудных детей, оказывает уникально биологическое и эмоциональное воздействие на здоровье как матери, так и ребенка.
Грудное вскармливание должно начинаться в течение 30 минут после рождения ребенка.

 

Увеличение частоты кормлений стимулирует выработку молока, поэтому ребенок должен кормиться по его желанию, а не по часам, и так часто, как он захочет.
Продолжительность каждого кормления тоже определяется самим ребенком – он находится у груди так долго, как хочет.
Прикладывайте ребенка к груди правильно. И вы, и младенец должны получать удовольствие от кормления.

 

Кроме материнского молока, ребенок не нуждается ни в каких других продуктах питания или в питье, по крайней мере, до 4 месяцев. Вода замещает грудное молоко, снижает аппетит ребенка и, в конечном счете, выработку молока и продолжительность грудного вскармливания.
Не давайте малышу никаких видов сосок – это мешает малышу правильно сосать грудь.
При заболевании матери ее организм вырабатывает антитела, которые поступают с молоком к ребенку и защищают его от инфекции со стороны матери. Заболевшая мать должна продолжать кормить ребенка.
Грудное молоко предупреждает возникновение аллергии, так как содержит большие количества иммуноглобулина А.
Сосание только материнской груди обеспечивает правильное развитие зубов, мышц, лица.

 

Грудное молоко содержит антитела, которые защищают ребенка от болезнетворных вирусов и бактерий. Молозиво, которое образуется после родов, содержит самые высокие концентрации антител.
Грудное молоко обеспечивает лучшее развитие нервной системы, желудочно-кишечного тракта, дыхательной и эндокринной системы.
Грудное вскармливание удобно и чисто.

 

Вскармливание грудью хотя бы одного ребенка снижает риск заболевания раком молочной железы на 50%, защищает от рака яичников.
Грудное вскармливание укрепляет связь между матерью и ребенком не только в раннем возрасте, но и на всю жизнь.
Наслаждайтесь общением со своим ребенком. Контакт кожа к коже, глаза в глаза, ваша любовь к нему обеспечат вам душевную близость с вашим ребенком на многие годы.

 

Качественные преимущества женского молока

1. Грудное вскармливание – наивысшее искусство материнства.
2. Белки легко усваиваются.
3. Эталон идеального белка. Белки имеют наилучший аминокислотный состав.
4. Много иммуноглобулина – защита от болезней.
5. Обладает протеолитической активностью (имеет ферменты, расщепляющие белок в желудке ребёнка).
6. Высокое содержание ненасыщенных жирных кислот.
7. В-лактоза – поддерживает нормальную кишечную флору, не идут процессы гниения.
8. Больше витаминов Д, Е, А, С.
9. Железо, содержащееся в женском молоке лучше всасывается (чем в коровьем молоке).
10. Женское молоко стерильное.
11. Дети, вскормленные грудным молоком, имеют более высокий уровень интеллекта.

Отрицательные моменты искусственного вскармливания

1. Возможность проявления аллергии.
2. После термической обработки состав молока меняется.
3. Опасность инфицирования новорожденного.
4. В составе коровьего молока не содержится витаминов, нет антител.
5. Меняется флора в кишечнике ребёнка (гнилостная), стул оформлении и редкий.
6. Белки коровьего молока пагубно влияют на почки.
7. Связь ребёнка с матерью на расстоянии.
8. Дети чаще и тяжелее болеют, не получают чувство удовлетворённости от общения с матерью.

Затруднения и противопоказания к кормлению ребёнка грудью

Абсолютные противопоказания со стороны ребёнка:

1. Тяжёлые родовые травмы
2. Гемолитическая болезнь новорождённого.
3. Глубокая недоношенность.
4. Тяжёлые формы респираторных дыхательных расстройств.

Относительные противопоказания со стороны ребёнка:

1. Врождённые уродства.
2. Недоношенность.
3. Идиосинкразия.

 

 Абсолютные противопоказания со стороны матери:

1. Заболевание почек с почечной недостаточностью.
2. Пороки сердца с сердечной недостаточностью.
3. Тяжёлые формы болезни крови.
4. Выраженные формы Базедовой болезни.
5. Злокачественные опухоли.
6. Острые психические заболевания.
7. ВИЧ-инфекция.

 

Относительные противопоказания со стороны матери:

— Активная форма туберкулёза, сифилис.

 

Спасибо за отзыв!

Ваш отзыв был получен и отправлен администратору!

HSV-1 против HSV-2: в чем разница?

Основы HSV-1 и HSV-2

Вирус простого герпеса 1 и вирус простого герпеса 2 являются типами вируса герпеса. Из этих двух ВПГ-1 является наиболее распространенным: по оценкам, 67 процентов населения (среди людей от 14 до 49 лет) во всем мире были инфицированы этим вирусом в 2012 году. В период 2015–2016 годов среди людей 14 человек. до 49 лет распространенность ВПГ-1 составляла 47,8 процента по сравнению с ВПГ-2 — 11,9 процента.

ВПГ-2 менее распространен, но все еще широко распространен, по оценкам, в 2012 г. от него во всем мире страдали 11 процентов людей в возрасте от 15 до 49 лет. Показатели инфицирования ВПГ-1 и ВПГ-2 значительно различаются от страны к стране, хотя показатели инфицирования ВПГ-1 стабильно высоки во всем мире.

HSV-1 и HSV-2 являются пожизненными инфекциями без какого-либо известного лечения. Однако для лечения обоих типов вируса доступно множество безопасных, доступных и высокоэффективных лекарств.

Между HSV-1 и HSV-2 есть несколько ключевых различий, начиная от участков тела, на которые каждый вирус имеет тенденцию влиять, и заканчивая способом передачи вирусов.

Основы HSV-1

HSV-1 обычно поражает губы и рот, вызывая развитие орального герпеса (герпеса). Это чрезвычайно распространенный вирус, который обычно передается в детстве, обычно при контакте с родителем или другим членом семьи, у которого есть вирус.

Большинство людей инфицировано ВПГ-1, а это значит, что не нужно паниковать, если вы обнаружите, что у вас есть вирус. Многие люди протекают бессимптомно, что означает, что они переносят вирус и потенциально могут передать его другим, но не имеют никаких видимых, очевидных симптомов.

HSV-1 обычно вызывает вспышки герпеса вокруг рта, чаще всего известные как герпес. Между вспышками вирус находится в спящем состоянии в нейронах сенсорных ганглиев, группе нервных клеток около уха.

Хотя ВПГ-1 обычно поражает губы и рот, он также может распространяться на гениталии и приводить к генитальному герпесу. HSV-1 обычно распространяется на гениталии при оральном сексе и может распространяться с видимыми симптомами или без них.

Основы HSV-2

HSV-2 обычно поражает гениталии, вызывая образование поражений на и вокруг гениталий и ануса.Эта форма вируса обычно передается половым путем, хотя может также передаваться от матери к ребенку во время родов.

В отличие от ВПГ-1, ВПГ-2 очень редко распространяется на рот и губы. Эта форма вируса герпеса почти исключительно вызывает поражения половых органов. Подобно ВПГ-1, многие люди с ВПГ-2 не имеют симптомов и не подозревают, что инфицированы.

Фактически, по данным Всемирной организации здравоохранения, только от 10 до 20 процентов людей, инфицированных ВПГ-2, сообщают о предыдущем диагнозе генитального герпеса, а это означает, что до 90 процентов людей, инфицированных вирусом, даже не знают об этом. у них это есть.

Между вспышками ВПГ-2 остается в организме в спящем состоянии. Вирус прежде всего остается латентным в крестцовом ганглии, группе скоплений нервных клеток в нижнем отделе позвоночника.

HSV-2 чаще встречается у женщин, чем у мужчин: по оценкам, в 2012 году во всем мире было инфицировано 267 миллионов женщин и 150 миллионов мужчин. Это связано с тем, что вирус может легче передаваться от мужчин к женщинам, чем наоборот, в результате анатомические различия.

Симптомы HSV-1 и HSV-2

HSV-1 и HSV-2 вызывают аналогичные симптомы.Однако, поскольку две формы вируса поражают разные части тела, их симптомы обычно проявляются исключительно на губах и во рту или на гениталиях.

Симптомы ВПГ-1

ВПГ-1 чаще всего вызывает оральный герпес (герпес). Люди, инфицированные вирусом, обычно переживают первоначальную вспышку вскоре после заражения вирусом. Обычно это интенсивная вспышка, сопровождающаяся герпесом и разнообразными гриппоподобными симптомами.

Первоначальная вспышка ВПГ-1 может длиться от двух до трех недель.Наше руководство по остановке герпеса на ранних стадиях рассматривает различные стадии вспышки ВПГ-1, объясняя, как язва может развиваться, открываться и распространять инфекционную жидкость до того, как в конечном итоге зажить.

После первоначальной вспышки ВПГ-1 может повторяться по разным причинам. У некоторых людей с ВПГ-1 вспышки возникают каждые несколько месяцев, в то время как у других вспышки возникают только после наступления определенного триггерного события. Многие люди с ВПГ-1 вообще не испытывают никаких симптомов.

Хотя ВПГ-1 встречается редко, он также может вызывать генитальный герпес.В этом случае вирус поражает нервные клетки в нижней части позвоночника и вызывает образование язв на половых органах и анусе и вокруг них, а не на губах и рту.

Симптомы ВПГ-2

ВПГ-2 почти исключительно вызывает генитальный герпес. После заражения вирусом люди с ВПГ-2 обычно переживают первоначальную вспышку. Симптомы похожи на первоначальную вспышку ВПГ-1, хотя локализованы в гениталиях, а не во рту и губах.

Наиболее очевидным симптомом ВПГ-2 является развитие генитальных герпетических язв, которые могут образовываться на гениталиях, в паху, верхней части бедра и вокруг анального отверстия.

Первоначальные вспышки ВПГ-2 могут включать ряд дополнительных симптомов, таких как головная боль, усталость, отек желез и тошнота. Многие люди с ВПГ-2 ошибочно принимают первые симптомы за грипп до того, как становятся заметными генитальные поражения герпеса.

Как и ВПГ-1, начальные симптомы вспышки ВПГ-2 обычно длятся от двух до трех недель. Многие люди с ВПГ-2 вообще не испытывают никаких симптомов, в результате чего многие люди с ВПГ-2 не знают, что они инфицированы.

Осложнения HSV-1 и HSV-2

Вспышки HSV-1 обычно со временем становятся менее интенсивными, поскольку в организме развивается иммунный ответ на вирус.Вспышки HSV-1 также легко лечить с помощью противовирусных препаратов.

То же самое и с HSV-2. Даже у людей с симптомами заболевания организм со временем вырабатывает собственный иммунный ответ на вирус. Симптомы ВПГ-2 можно лечить с помощью противовирусных препаратов, которые ускоряют процесс заживления и уменьшают частоту вспышек.

Несмотря на это, и HSV-1, и HSV-2 могут вызывать некоторые осложнения. У людей со слабой или ослабленной иммунной системой, таких как люди с ВИЧ, и ВПГ-1, и ВПГ-2 могут вызвать длительное повреждение глаз и мозга.

ВПГ-1 и ВПГ-2 потенциально могут вызывать неонатальный герпес. Это потенциально смертельный вирус, вызванный вертикальной передачей герпеса от матери к ребенку. Неонатальный герпес очень редок, поражая от одного из 3000 до одного из 20 000 новорожденных во всем мире.

Наконец, обе формы герпеса могут иметь значительное социальное и психологическое воздействие. Если ВПГ-1 вызывает видимый герпес, это может повлиять на уверенность в себе и качество жизни. ВПГ-2 может привести к значительному изменению сексуального поведения, особенно к потере сексуальной уверенности в себе.

Лечение HSV-1 и HSV-2

Вспышки HSV-1 и HSV-2 лечить легко и недорого. Наиболее широко применяемыми препаратами от обеих форм вируса герпеса являются противовирусные препараты, такие как валацикловир (Валтрекс®) и ацикловир (Зовиракс).

Противовирусные препараты работают, предотвращая развитие вируса герпеса, помогая контролировать вспышки герпеса и снижая риск заражения других людей. Исследования показывают, что такие препараты, как валацикловир, очень эффективны для ускорения заживления после вспышек герпеса и снижения рисков передачи.

В нашем руководстве по валацикловиру 101 более подробно рассказывается о том, как валацикловир можно использовать для лечения обоих штаммов вируса герпеса.

Генитальный герпес — Premier Medical Group

Что такое генитальный герпес?

Вернуться наверх

Генитальный герпес — это заболевание, передающееся половым путем, которое поражает преимущественно гениталии и анальную область. Вирус может вызывать образование ядер в области гениталий и прямой кишки, ягодицах и бедрах. Генитальный герпес чаще всего передается через вагинальный, анальный или оральный секс с партнером, у которого есть вирус, и может распространяться даже при отсутствии язв.Беременные родители также могут заразить своих малышей во время родов.

Генитальный герпес значительно увеличился у лиц моложе 25 лет. Воздержание — единственная надежная защита от герпеса, которую человек может предпринять, но использование презервативов и других мер предосторожности может значительно снизить риск.

Что вызывает генитальный герпес?

Вернуться наверх

Генитальный герпес вызывается вирусом простого герпеса или ВПГ-2.ВПГ-1, вызывающий оральный герпес, все чаще становится причиной генитального герпеса. Если у человека нет герпеса, он может заразиться при контакте с вирусом в одной из нескольких форм. Это включает в себя герпетическую язву, зажившую или открытую, слюну, генитальные выделения или, в некоторых случаях, кожу. Вирус может распространяться даже тогда, когда симптомы не видны.

Вопреки распространенному мнению, заразиться герпесом через сиденья унитаза, постельные принадлежности и бассейны невозможно.Вирус не может жить вне тела.

Каковы симптомы генитального герпеса?

Вернуться наверх

Симптомы герпеса обычно называют «вспышками». В большинстве случаев первая вспышка болезни происходит примерно через две недели после первого контакта с вирусом. Когда это происходит, часто появляются язвы рядом с местом проникновения вируса в организм. Эти язвы могут образовывать волдыри и разламываться, что может быть очень болезненным, а затем заживают, как правило, в течение 7-10 дней.

Вирус герпеса остается в организме на всю жизнь, но со временем вспышки могут становиться все менее частыми. Зуд и боль могут возникать даже при отсутствии язв. Фактически, у большинства людей с герпесом нет симптомов, но даже без признаков болезни вирус может продолжать распространяться на половых партнеров. Поэтому важно пройти тестирование на вирус и принять необходимые меры предосторожности, такие как использование латексного презерватива и информирование половых партнеров о ЗППП.

Как диагностируется генитальный герпес?

Вернуться наверх

Хотя человек может диагностировать герпес на глаз, только врач может поставить точный диагноз.Если язвы видны, врач возьмет образец тампоном и оценит его на предмет наличия вируса. Если во время визита нет видимых язв, врач может использовать образец крови для определения тех же результатов.

Даже если вы не подозреваете, что у вас вирус герпеса, важно регулярно проходить тест на ЗППП. Большинство распространенных ЗППП не имеют симптомов, но без лечения они могут нанести долговременный вред. Если вы решите пройти стандартный тест на ЗППП во время следующего медосмотра, тест на герпес может быть не включен (большинство тестов на ЗППП включают образцы мочи, а не крови).Если вы хотите добавить этот тест, поговорите со своим врачом.

Какие популярные методы лечения генитального герпеса?

Вернуться наверх

Хотя от генитального герпеса нет лекарства, некоторые лекарства могут помочь облегчить симптомы, уменьшить вспышки и снизить риск передачи вируса другому человеку. Если вы ищете способы облегчить вспышку болезни, вы можете предпринять несколько простых шагов.

  • Примите теплую ванну
  • Следите за тем, чтобы пораженный участок оставался сухим
  • Носить мягкую свободную одежду
  • Поместите пакет со льдом на язвы
  • Примите обезболивающее, например аспирин, ибупрофен или ацетаминофен

Если у вас частые вспышки, врач может назначить ежедневное лекарство.Это называется супрессивной терапией, которая может помочь предотвратить будущие вспышки и снизить вероятность передачи герпеса половым партнерам.

Когда обращаться к врачу при генитальном герпесе?

Вернуться наверх

Обратитесь к врачу, если подозреваете, что заразились вирусом герпеса. Они смогут поставить диагноз и порекомендовать лекарства, которые помогут справиться с симптомами и предотвратить дальнейшее распространение. Более того, другие ЗППП, такие как сифилис, могут выглядеть как герпес, но требуют другого лечения.Если вы подозреваете, что у вас герпес или другое ЗППП, как можно скорее обратитесь к врачу. Только они смогут провести правильный диагноз и курс лечения. Если вы считаете, что у вас может быть отдельный ЗППП, загляните на нашу главную информационную страницу о заболеваниях, передающихся половым путем.

Human Herpes Virus 6 — HealthyChildren.org

Roseola, также называемая exanthem subitum и шестым заболеванием, является распространенной контагиозной вирусной инфекцией, вызываемой вирусом герпеса человека (HHV) 6. Этот штамм вируса герпеса отличается от того, что вызывает герпес или генитальный герпес.

Розеола чаще всего встречается у детей в возрасте от 6 до 24 месяцев. У молодых обычно высокая температура (выше 103 ° F или 39,5 ° C) в течение 3–7 дней. После того, как температура исчезнет, ​​на туловище появится сыпь, которая распространится на руки, ноги, спину и лицо. Эта сыпь обычно длится несколько часов, но в некоторых случаях сохраняется в течение нескольких дней. У некоторых детей бывают судороги, связанные с высокой температурой, но чаще лихорадка сопровождается снижением аппетита, легким кашлем и насморком.Такая картина, когда высокая температура сменяется сыпью, поможет вашему педиатру поставить диагноз этой инфекции. Однако HHV-6 также может вызывать лихорадку без сыпи или сыпь без лихорадки.

Вирус герпеса человека 6 передается от человека к человеку через выделения из дыхательных путей. Вы можете снизить вероятность заражения вашего ребенка, если будете тщательно и часто мыть руки. Специального лечения розеолы не существует, и обычно она проходит, не вызывая никаких осложнений.Если у вашего ребенка повышенная температура, попросите своего педиатра снизить температуру с помощью ацетаминофена.

Подобные симптомы связаны с другой герпесвирусной инфекцией, вызываемой HHV-7. Многие дети, инфицированные HHV-7, имеют лишь легкое заболевание. Вирус герпеса человека 7 может быть причиной повторных или повторных случаев розеолы, которые первоначально были вызваны HHV-6. Как и все вирусы семейства герпесных, эти вирусы остаются в организме на всю жизнь. Если иммунная система человека ослабляется из-за болезни или лекарств, вирус может появиться снова, вызывая лихорадку и инфекцию в легких или головном мозге.

Информация, содержащаяся на этом веб-сайте, не должна использоваться вместо медицинской помощи и рекомендаций вашего педиатра. Ваш педиатр может порекомендовать лечение по-разному, исходя из индивидуальных фактов и обстоятельств.

Разработка новых субъединичных вакцин против вируса простого герпеса-1 с использованием подхода обратной вакцинологии

1. Введение

Вирус простого герпеса (HSV)

является членом семейства herpesviridae.HSV представляет собой двухцепочечный ДНК, содержащий вирус с икозапентаэдрическим капсидом. ВПГ-1 и ВПГ-2 — два самых опасных типа герпеса. ВПГ-1 в основном вызывает орофациальные инфекции, а ВПГ-2 обычно вызывает генитальные инфекции [1, 2]. Вирус HSV-1 передается от человека к человеку главным образом при орально-оральном контакте и вызывает заболевание, известное как герпес. Инфекция HSV-1 широко распространена во всем мире, и во многих случаях инфекция может оставаться скрытой или невыявленной на протяжении всей жизни инфицированного человека.Иногда инфекция может привести к очень опасным заболеваниям, таким как энцефалит. С другой стороны, ВПГ-2 — это в основном вирус, передающийся половым путем, и поэтому он в основном вызывает генитальный герпес. Согласно исследованию, общее количество новых случаев HSV-1 в 2012 году оценивалось в 118 миллионов [3, 4]. Более того, глобальная заболеваемость ВПГ-2 в 2012 году оценивалась примерно в 417 миллионов человек [5]. Иногда инфицирование ВПГ приводит к другим заболеваниям, таким как болезнь Альцгеймера и печеночная недостаточность [6, 7].В настоящее время лечение ВПГ проводится с использованием многих противовирусных препаратов, таких как ацикловир, валацикловир, фамцикловир и т. Д. Однако во многих случаях такие противовирусные препараты не смогли обеспечить полную устойчивость к ВПГ и снизить уровень смертности пациентов, инфицированных ВПГ. Более того, исследования доказали, что вирусная резистентность вируса герпеса к таким лекарствам (например, ацикловиру) также может иметь место, и такая частота может усложнять лечение [8, 9, 10, 11]. Хотя исследователи работают над разработкой эффективной вакцины против вируса герпеса, такой как субъединичные вакцины, инактивированные вирионные вакцины, генетически аттенуированные вакцины и т. Д.На сегодняшний день удовлетворительная вакцина не поступила на рынок успешно [12]. В этом исследовании обратный подход к вакцинологии и биоинформатике был использован для разработки эффективной вакцины против герпеса против вируса простого герпеса-1, штамма-17 (, фиг. 01, ). Обратная вакцинология определяется как процесс разработки вакцины, при котором новые антигены вируса или организма идентифицируются путем анализа геномной информации этого конкретного организма или вируса. В обратной вакцинологии используются различные инструменты биоинформатики для идентификации новых антигенов, полезных для разработки вакцины, путем анализа генома, а также для изучения генетического состава патогена.Такой подход к разработке вакцины также помогает ученым понять, каким антигенным сегментам вируса или патогена следует уделять особое внимание при разработке вакцины. Этот метод является быстрым, простым и экономичным способом создания вакцины. Обратная вакцинология успешно используется для разработки вакцин против многих вирусов, таких как вирус Зика, вирус Чикунгунья и др. [13, 14].

2. Материалы и методы

Эксперимент направлен на разработку вакцин против вируса простого герпеса человека-1 (штамм-17).

2.1. Идентификация и отбор штамма

Вирус простого герпеса-1 (штамм-17) был идентифицирован и выбран путем анализа и просмотра различных записей на онлайн-сервере Национального центра биотехнологической информации или NCBI (https: //www.ncbi.nlm. nih.gov/).

2.2. Получение белковых последовательностей

Девять вирусных белков: гликопротеин оболочки M (номер доступа: P04288), гликопротеин оболочки H (номер доступа: P06477), гликопротеин оболочки E (номер доступа: P04488), гликопротеин оболочки I (номер доступа: P06487) , гликопротеин оболочки B (номер доступа: P10211), гликопротеин оболочки L (номер доступа: P10185), гликопротеин оболочки D (номер доступа: Q69091), гликопротеин оболочки K (номер доступа: P68331) и гликопротеин оболочки C (номер доступа: P10228) были получены из инструмента UniProt Knowledgebase (UniProtKB) онлайн-сервера UniProt (https: // www.uniprot.org/).

2.3. Прогнозирование антигенности и анализ физико-химических свойств белковых последовательностей

Антигенность белковых последовательностей была предсказана онлайн-сервером VaxiJen v2.0 (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.htm) , сохраняя порог на уровне 0,4 и использовалась модель опухоли [15, 16, 17]. Для дальнейшего анализа были выбраны только антигенные белки. Различные физико-химические свойства выбранных последовательностей антигенных белков определяли с помощью онлайн-инструмента ExPASy ProtParam (https: // web.expasy.org/protparam/) [18].

2.4. Предсказание Т-клеточных и В-клеточных эпитопов

Т-клеточные и В-клеточные эпитопы выбранных белковых последовательностей были предсказаны с использованием онлайн-сервера предсказания эпитопов Immune Epitope Database или IEDB (https://www.iedb.org/). База данных IEDB содержит огромное количество экспериментальных данных о Т-клеточных эпитопах, а также об антителах. Эти данные собираются в ходе различных исследований, проводимых на людях, приматах и ​​других животных. Это сервер, который позволяет проводить надежный анализ различных эпитопов с использованием различных инструментов: охват популяции, консервация по антигенам и кластерам с похожими последовательностями [19].Ограниченные MHC класса I CD8 + цитотоксические Т-лимфоциты (CTL) эпитопов выбранных последовательностей были получены с использованием метода прогнозирования NetMHCpan EL 4.0 для аллеля HLA-A * 11-01. Эпитопы CD4 + хелперных Т-лимфоцитов (HTL), ограниченные MHC класса II, были получены для аллеля HLA DRB1 * 04-01 с использованием метода предсказания Стурниоло. Десять лучших MHC класса I были отобраны на основе их баллов в процентилях и баллах антигенности (AS). Более того, предсказание эпитопа MHC класса II генерировало несколько эпитопов с аналогичными показателями AS и процентилей.Однако по 2 эпитопа было взято из каждой из пяти основных категорий. С другой стороны, пять случайных эпитопов B-клеточных лимфоцитов (BCL) были отобраны на основе их длины (были отобраны последовательности эпитопа, которые имели десять аминокислот или более) и получены с использованием метода предсказания двупроводникового линейного эпитопа, сохраняя параметры по умолчанию.

2,5. Трансмембранная топология и прогнозирование антигенности выбранных эпитопов

Трансмембранную топологию выбранных эпитопов определяли с использованием трансмембранной топологии детерминанты белковых спиралей TMHMM v2.0 (http://www.cbs.dtu.dk/services/TMHMM/). Сервер предсказывает, будет ли эпитоп трансмембранным или он останется внутри или вне мембраны [20]. Антигенность выбранных эпитопов была предсказана с использованием VaxiJen v2.0 (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.htm), используя модель опухоли и порог 0,4.

2.6. Прогнозирование аллергенности и токсичности эпитопов

Аллергенность выбранных эпитопов прогнозировали с помощью двух онлайн-инструментов, AllerTOP v2.0 (https://www.ddg-pharmfac.net/AllerTOP/) и AllergenFP v1.0 (http://ddg-pharmfac.net/AllergenFP/). Однако результаты, предсказанные AllerTOP, получили приоритет, поскольку сервер имеет лучшую точность на 88,7%, чем сервер AllergenFP (87,9%) [21, 22]. Прогнозирование токсичности выбранных эпитопов осуществлялось с использованием сервера ToxinPred (http://crdd.osdd.net/raghava/toxinpred/) с использованием метода на основе SVM (Swiss-Prot), сохраняя все параметры по умолчанию.

2.7. Прогнозирование консервативности выбранных эпитопов

Анализ консервативности выбранных эпитопов выполняли с использованием инструмента «анализа консервативности эпитопа» сервера IEDB (https: // www.iedb.org/conservancy/) [19]. Порог идентичности последовательности поддерживался «> = 50». Для анализа консервативности выбранных эпитопов штамма-1 вируса простого герпеса-1, гликопротеина оболочки E, гликопротеина оболочки B и гликопротеина оболочки D штамма F вируса простого герпеса человека-1 и штамма 2 вируса простого герпеса человека: HG52 использовали для сравнения вместе с белками самого штамма 17 вируса простого герпеса человека 1 (номера доступа UniProt: P89475, Q703F0, P04488, P08666, P06436, P10211, Q69467, Q05059 и Q69091).Это гарантирует, что последовательности эпитопа сохраняются для всех видов, а также для штаммов. На основании анализа антигенности, аллергенности, токсичности и консервативности были отобраны лучшие лиганды для дальнейшего анализа и конструирования вакцины. Эпитопы, которые проявили антигенность, неаллергенность, нетоксичность и высокую (более 90%) консервативность и минимальную идентичность более 50%, считались лучшими эпитопами. Для выбора эпитопа В-клеток для дальнейшего анализа брали только антигенные и неаллергенные эпитопы.

2,8. Кластерный анализ аллелей MHC

Кластерный анализ аллелей MHC помогает идентифицировать аллели молекул MHC класса I и класса II, которые имеют сходную специфичность связывания. Кластерный анализ аллелей MHC проводили с помощью онлайн-инструмента MHCcluster 2.0 (http://www.cbs.dtu.dk/services/MHCcluster/) [23]. Во время анализа количество включаемых пептидов составляло 50 000, количество вычислений начальной загрузки составляло 100, и были отобраны все представители супертипа HLA (MHC класс-I) и представители HLA-DR (MHC класс-II).Для анализа аллелей MHC класса I использовали метод прогнозирования NetMHCpan-2.8. Результат сервера сгенерировал результаты в виде дерева специфичности MHC и тепловой карты специфичности MHC.

2.10. Молекулярный докинг выбранных эпитопов

Молекулярный докинг выбранных эпитопов с белками MHC класса I и класса II был выполнен с помощью онлайн-докинга PatchDock (https://bioinfo3d.cs.tau.ac.il/PatchDock /php.php). Инструмент PatchDock разделяет точечное представление молекул на поверхности Коннолли на вогнутые, выпуклые и плоские участки, используя различные алгоритмы.После этого сопоставляются дополнительные патчи для генерации потенциальных преобразований-кандидатов. Затем каждое из возможных преобразований оценивается с помощью функции оценки, а затем кластеризация RMSD (среднеквадратичное отклонение) применяется к возможным решениям для отбрасывания избыточных решений. Решения с наивысшим рейтингом становятся решениями с наивысшим рейтингом сервером. После стыковки с помощью PatchDock результаты стыковки были уточнены и повторно оценены сервером FireDock (http: // bioinfo3d.cs.tau.ac.il/FireDock/php.php). Сервер FireDock генерирует глобальную энергию после уточнения лучших решений от сервера PatchDock и ранжирует их на основе генерируемых глобальных энергий, и самая низкая глобальная энергия всегда заметна и предпочтительна [27, 28, 29, 30]. Эксперименты по молекулярному докингу проводили с использованием аллеля HLA-A * 11-01 (PDB ID: 5WJL) и HLA DRB1 * 04-01 (PDB ID: 5JLZ) в качестве рецепторов, и лиганды были наилучшим образом выбранными MHC-I и MHC. -II эпитопы соответственно.Рецепторы были загружены с сервера RCSB-Protein Data Bank (https://www.rcsb.org/). Лучшие результаты были визуализированы с помощью Discovery Studio Visualizer [31].

2.11. Конструирование вакцины

Были сконструированы три возможные вакцины против вируса простого герпеса-1, штамм-17. Предсказанные эпитопы CTL, HTL и BCL конъюгировали вместе для конструирования вакцин. Все вакцины были созданы с сохранением последовательности: адъювант, последовательность PADRE, эпитопы CTL, эпитопы HTL и эпитопы BCL.Три разные адъювантные последовательности использовали для создания трех разных вакцин: бета-дефенсин, рибосомный белок L7 / L12 и белок HABA ( M. tuberculosis , номер доступа: AGV15514.1). Адъюванты бета-дефенсина вызывают активацию толл-подобных рецепторов (TLR): 1, 2 и 4, где бета-дефенсин действует как агонист. Рибосомный белок L7 / L12 и белок HABA активируют TLR-4. Во время конструирования вакцины использовали различные линкеры: линкеры EAAAK использовали для конъюгирования адъюванта и последовательности PADRE, линкеры GGGS использовали для присоединения последовательности PADRE с эпитопами CTL и эпитопов CTL с другими эпитопами CTL, линкеры GPGPG использовали для связывают CTL с эпитопами HTL, а также эпитопами HTL между собой.Линкеры KK использовали для конъюгирования эпитопов HTL и BCL, а также эпитопов BLC между собой [32, 33, 34, 35, 36, 37, 38]. Исследования доказали, что последовательность PADRE улучшает CTL-ответ содержащих ее вакцин [39]. Всего в эксперименте были сконструированы три вакцины.

2.12. Анализ антигенности, аллергенности и физико-химических свойств

Антигенность сконструированных вакцин определялась онлайн-сервером VaxiJen v2.0 (http: // www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.htm). Порог прогноза был сохранен на уровне 0,4. AlgPred (http://crdd.osdd.net/raghava/algpred/) и AllerTop v2.0 (https://www.ddg-pharmfac.net/AllerTOP/) использовались для прогнозирования аллергенности вакцинных конструкций. . Сервер AlgPred предсказывает возможные аллергены на основе сходства известного эпитопа любого известного участка белка [40]. Подход к прогнозированию мотива цМем / МАСТ используется для прогнозирования аллергенности вакцин с помощью AlgPred.Кроме того, различные физико-химические свойства вакцин были исследованы онлайн-сервером ProtParam (https://web.expasy.org/protparam/).

2.13. Прогнозирование вторичной и третичной структуры вакцинных конструкций

Вторичные структуры вакцинных конструкций были созданы с использованием онлайн-инструмента PRISPRED (http://bioinf.cs.ucl.ac.uk/psipred/). PRISPRED — это простой генератор вторичных структур, который можно использовать для прогнозирования трансмембранной топологии, трансмембранной спирали, распознавания складок и доменов и т. Д.наряду с предсказанием вторичной структуры [41, 42]. Метод прогнозирования PRISPRED 4.0 использовался для прогнозирования вторичных структур вакцинных конструкций. Структура β-листов вакцин определялась другим онлайн-инструментом NetTurnP v1.0 (http://www.cbs.dtu.dk/services/NetTurnP/) [43]. Третичные или трехмерные структуры вакцин были созданы с использованием онлайн-инструмента RaptorX (http://raptorx.uchicago.edu/) server. Сервер представляет собой полностью аннотированный инструмент для предсказания структуры белка, предсказания свойств и контактов, выравнивания последовательностей и т. Д.[44, 45, 46].

2.14. Уточнение и проверка трехмерной структуры

Трехмерные структуры сконструированных вакцин были уточнены с помощью онлайн-инструмента уточнения 3Drefine (http://sysbio.rnet.missouri.edu/3Drefine/). Сервер — это быстрый, простой и эффективный инструмент для уточнения структуры белков [47]. Для каждой вакцины была загружена уточненная модель 1 для проверки. Затем очищенные вакцинные белки были проверены путем анализа графиков Рамачандрана, которые были созданы с помощью онлайн-инструмента PROCHECK (https: // servicesn.mbi.ucla.edu/PROCHECK/) [48, 49].

2.15. Разработка дисульфида белка вакцины

Инжиниринг дисульфида белка вакцины выполняли с помощью онлайн-инструмента Disulfide by Design 2 v12.2 (http://cptweb.cpt.wayne.edu/DbD2/). Сервер предсказывает возможные сайты в структуре белка, которые имеют большую вероятность образования дисульфидной связи [50]. При конструировании дисульфидных связей были выбраны внутрицепочечные, межцепочечные и C β для остатка глицина.Угол χ 3 сохранялся -87 ° или + 97 ° ± 5 и C α -C β -S γ Угол составлял 114,6 ° ± 10.

2.16. Стыковка белок-белок

При стыковке белок-белок сконструированные вакцины вируса простого герпеса-1, штамм-17 анализировали стыковкой против различных аллелей MHC и толл-подобных рецепторов (TLR). Одна лучшая вакцина была выбрана на основе их результатов в стыковочном эксперименте. Когда возникают вирусные инфекции, вирусные частицы распознаются комплексом MHC как антигены.Различные сегменты молекул MHC кодируются разными аллелями. По этой причине вакцины должны обладать хорошей аффинностью связывания с этими участками MHC, которые кодируются разными аллелями [51]. Все конструкции вакцины стыковали с выбранными аллелями MHC для проверки их аффинности связывания. В этом эксперименте конструкции вакцин были состыкованы с DRB1 * 0101 (PDB ID: 2FSE), DRB3 * 0202 (PDB ID: 1A6A), DRB5 * 0101 (PDB ID: 1h25), DRB3 * 0101 (PDB ID: 2Q6W),

Аллели DRB1 * 0401 (PDB ID: 2SEB) и DRB1 * 0301 (PDB ID: 3C5J).Более того, исследования доказали, что TLR-8, которые присутствуют на иммунных клетках, ответственны за опосредование иммунных ответов против РНК-вирусов, а TLR-3 иммунных клеток опосредует иммунные ответы против ДНК-вирусов [52, 53]. Вирус герпеса представляет собой ДНК-вирус 9540. По этой причине конструкции вакцины вируса герпеса также стыковались с TLR-3 (PDB ID: 2A0Z). Белковая стыковка проводилась с использованием различных онлайн-стыковок. Стыковка выполнялась трижды тремя разными онлайн-серверами для повышения точности стыковки.Сначала стыковку производил ClusPro 2.0 (https://cluspro.bu.edu/login.php). Сервер ранжирует кластеры пристыкованных комплексов на основе их центра и наименьшего количества энергии. Однако эти оценки не отражают фактического сродства связывания белков с их мишенями [55, 56, 57]. Аффинность связывания (ΔG в ккал / моль -1 ) стыкованных комплексов была получена с помощью инструмента PRODIGY веб-сервера HADDOCK (https://haddock.science.uu.nl/). Чем ниже энергия связывания, генерируемая сервером, тем выше аффинность связывания [58, 59, 60].Более того, стыковка снова была выполнена PatchDock (https://bioinfo3d.cs.tau.ac.il/PatchDock/php.php), а позже доработана и повторно оценена сервером FireDock (http: //bioinfo3d.cs.tau .ac.il / FireDock / php.php). Сервер FireDock ранжирует пристыкованные комплексы на основе их общей энергии, и чем ниже оценка, тем лучше результат. Позже стыковка была произведена с помощью сервера HawkDock (http://cadd.zju.edu.cn/hawkdock/). Исследование молекулярной механики / обобщенной площади борновой поверхности (MM-GBSA) также проводилось с использованием сервера HawkDock.Согласно серверу, более низкая оценка и более низкая энергия соответствуют лучшим оценкам [61, 62, 63, 64]. Сервер HawkDock генерирует несколько моделей пристыкованного комплекса и ранжирует их, присваивая оценки HawkDock в порядке возрастания. Для каждой вакцины и их соответствующих мишеней для анализа брали оценку модели 1. Кроме того, модель 1 каждого комплекса была проанализирована для исследования MM-GBSA. Из эксперимента по стыковке была выбрана одна лучшая вакцина для дальнейшего анализа. Пристыкованные структуры визуализировались с помощью инструмента PyMol [65].

2.17. Молекулярно-динамическое моделирование

Моделирование молекулярной динамики проводилось на наиболее отобранной вакцине HV-1. Исследование проводилось на онлайн-сервере iMODS (http://imods.chaconlab.org/). iMODS можно эффективно использовать для исследования структурной динамики белковых комплексов, поскольку это быстрый, простой и удобный сервер. Сервер предоставляет значения деформируемости, B-фактора (профили подвижности), собственных значений, дисперсии, карты ковариации и эластичной сети для белка или стыкованного белок-белкового комплекса.Деформируемость зависит от способности деформироваться каждой из его аминокислот. Собственное значение связано с энергией, необходимой для деформации данной структуры, а меньшее собственное значение соответствует более легкой деформируемости комплекса. Собственное значение также представляет жесткость движения белкового комплекса. Сервер — это быстрый и простой инструмент для определения и измерения гибкости белков [66, 67, 68, 69, 70]. Для анализа молекулярно-динамического моделирования был использован стыкованный комплекс HV-1-TLR-3.Пристыкованные файлы PDB были загружены на сервер iMODS, и результаты были отображены с сохранением всех параметров по умолчанию.

2.18. Адаптация кодонов и клонирование in silico

Адаптацию кодонов и клонирование in silico проводили для наилучшего отобранного вакцинного белка HV-1. Для проведения этих экспериментов белок вакцины подвергали обратной транскрипции в возможные последовательности ДНК. Последовательность ДНК должна кодировать целевой вакцинный белок. Позже последовательности ДНК с обратной транскрипцией были адаптированы в соответствии с желаемым организмом, чтобы клеточные механизмы этого конкретного организма могли эффективно использовать кодоны адаптированных последовательностей ДНК и обеспечивать лучшее производство желаемого продукта.Адаптация кодонов является необходимым этапом клонирования in silico, поскольку одна и та же аминокислота может кодироваться разными кодонами в разных организмах, явление, которое известно как смещение кодонов. Более того, клеточные механизмы одного организма могут отличаться от клеточных механизмов другого организма, и кодон конкретной аминокислоты может не работать в другом организме. По этой причине выполняется этап адаптации кодона, который может предсказать подходящий кодон, который может кодировать конкретную аминокислоту в конкретном организме [71, 72].Кодоновую адаптацию выбранного вакцинного белка проводили с помощью Java Codon Adaptation Tool или сервера JCat (http://www.jcat.de/) [71]. Был выбран эукариотический штамм К12 E. coli и исключены rho-независимые терминаторы транскрипции, сайты связывания прокариотических рибосом и сайты расщепления SgrA1 и SphI рестрикционными ферментами. На сервере JCat последовательности белков были обратно транслированы в оптимизированные возможные последовательности ДНК. Были взяты оптимизированные последовательности ДНК, и сайты рестрикции SgrA1 и SphI были конъюгированы на N-концевом и C-концевом сайтах соответственно.Затем использовали модуль рестрикционного клонирования SnapGene [73] для вставки новых адаптированных последовательностей ДНК между SgrA1 и SphI вектора pET-19b.

3. Результаты

3.1. Идентификация, отбор и поиск последовательностей вирусных белков

Штамм 17 вируса простого герпеса был идентифицирован и выбран из NCBI (https://www.ncbi.nlm.nih.gov/). Девять белков оболочки из вирусной структуры были выбраны для возможной конструкции вакцины. Эти белки были: гликопротеин оболочки M (номер доступа: P04288), гликопротеин оболочки H (номер доступа: P06477), гликопротеин E оболочки (номер доступа: P04488), гликопротеин оболочки I (номер доступа: P06487), гликопротеин оболочки B (номер доступа : P10211), гликопротеин оболочки L (номер доступа: P10185), гликопротеин оболочки D (номер доступа: Q69091), гликопротеин оболочки K (номер доступа: P68331) и гликопротеин оболочки C (номер доступа: P10228).Последовательности белков были получены с онлайн-сервера UniProt (https://www.uniprot.org/). Белковые последовательности в формате FASTA:

> зр | P04288 | GM_HHV11 Конверт гликопротеин М ОС = Человеческий вирус герпеса 1 (штамм 17) ОХ = 10299 Г.Н. = Gm РЕ = 1 SV = 1 MGRPAPRGSPDSAPPTKGMTGARTAWWVWCVQVATFVVSAVCVTGLLVLASVFRARF PCFYATASSYAGVNSTAEVRGGVAVPLRLDTQSLVGTYVITAVLLLAVAVYAVVGAVT SRYDRALDAGRRLAAARMAMPHATLIAGNVCSWLLQITVLLLAHRISQLAHLVYVLHF ACLVYFAAHFCTRGVLSGTYLRQVHGLMELAPTHHRVVGPARAVLTNALLLGVFLCTA DAAVSLNTIAAFNFNFSAPGMLICLTVLFAILVVSLLLVVEGVLCHYVRVLVGPHLGAV AATGIVGLACEHYYTNGYYVVETQWPGAQTGVRVALALVAAFALGMAVLRCTRAYL YHRRHHTKFFMRMRDTRHRAHSALKRVRSSMRGSRDGRHRPAPGSPPGIPEYAEDPYAI SYGGQLDRYGDSDGEPIYDEVADDQTDVLYAKIQHPRHLPDDDPIYDTVGGYDPEPAED PVYSTVRRW

> зр | P06477 | GH_HHV11 Конверт гликопротеин Н ОС = Человеческий вирус герпеса 1 (штамм 17) ОХ = 10299 Г.Н. = Gh РЕ = 1 SV = 1 MGNGLWFVGVIILGVAWGQVHDWTEQTDPWFLDGLGMDRMYWRDTNTGRLWLPNT PDPQKPPRGFLAPPDELNLTTASLPLLRWYEERFCFVLVTTAEFPRDPGQLLYIPKTYLLG RPPNASLPAPTTVEPTAQPPPSVAPLKGLLHNPAASVLLRSRAWVTFSAVPDPEALTFPR GDNVATASHPSGPRDTPPPRPPVGARRHPTTELDITHLHNASTTWLATRGLLRSPGRYV YFSPSA STWPVGIWTTGELVLGCDAALVRARYGREFMGLVISMHDSPPVEVMVVPAGQ TLDRVGDPADENPPGALPGPPGGPRYRVFVLGSLTRADNGSALDALRRVGGYPEEGTN YAQFLSRAYAEFFSGDAGAEQGPRPPLFWRLTGLLATSGFAFVNAAHANGAVCLSDLL GFLAHSRALAGLAARGAAGCAADSVFFNVSVLDPTARLQLEARLQHLVAEILEREQSLA LHALGYQLAFVLDSPSAYDAVAPSAAHLIDALYAEFLGGRVLTTPVVHRALFYASAVLR QPFLAGVPSAVQRERARRSLLIASALCTSDVAAATNADLRTALARADHQKTLFWLPDHF SPCAASLRFDLDESVFILDALAQATRSETPVEVLAQQTHGLASTLTRWAHYNALIRAFVP EASHRCGGQSANVEPRILVPITHNASYVVTHSPLPRGIGYKLTGVDVRRPLFLTYLTATC EGSTRDIESKRLVRTQNQRDLGLVGAVFMRYTPAGEVMSVLLVDTDNTQQQIAAGPTE GAPSVFSSDVPSTALLLFPNGTVIHLLAFDTQPVAAIAPGFLAASALGVVMITAALAGILK VLRTSVPFFWRRE

> зр | P04488 | GE_HHV11 Конверт гликопротеин Е ОС = Человеческий вирус герпеса 1 (штамм 17) ОХ = 10299 Г.Н. = gé РЕ = 1 SV = 1 MDRGAVVGFLLGVCVVSCLAGTPKTSWRRVSVGEDVSLLPAPGPTGRGPTQKLLWAV EPLDGCGPLHPSWVSLMPPKQVPETVVDAACMRAPVPLAMAYAPPAPSATGGLRTDFV WQERAAVVNRSLVIHGVRETDSGLYTLSVGDIKDPARQVASVVLVVQPAPVPTPPPTPA DYDEDDNDEGEDESLAGTPASGTPRLPPPPAPPRSWPSAPEVSHVRGVTVRMETPEAILF SPGETFSTNVSIHAIAHDDQTYSMDVVWLRFDVPTSC AEMRIYESCLYHPQLPECLSPAD APCAASTWTSRLAVRSYAGCSRTNPPPRCSAEAHMEPVPGLAWQAASVNLEFRDASPQ HSGLYLCVVYVNDHIHAWGHITISTAAQYRNAVVEQPLPQRGADLAEPTHPHVGAPPH APPTHGALRLGAVMGAALLLSALGLSVWACMTCWRRRAWRAVKSRASGKGPTYIRV ADSELYADWSSDSEGERDQVPWLAPPERPDSPSTNGSGFEILSPTAPSVYPRSDGHQSRR QLTTFGSGRPDRRYSQASDSSVFW

> зр | P06487 | GI_HHV11 Envelope гликопротеин I OS = Человеческий вирус герпеса 1 (штамм 17) OX = 10299 GN = GĮ PE = 1 SV = 1 MPCRPLQGLVLVGLWVCATSLVVRGPTVSLVSNSFVDAGALGPDGVVEEDLLILGELRF VGDQVPHTTYYDGGVELWHYPMGHKCPRVVHVVTVTACPRRPAVAFALCRATDSTHS PAYPTLELNLAQQPLLRVQRATRDYAGVYVLRVWVGDAPNASLFVLGMAIAAEGTLA YNGSAYGSCDPKLLPSSAPRLAPASVYQPAPNQASTPSTTTSTPSTTIPAPSTTIPAPQAST TPFPTGDPKPQPPGVNHEPPSNATRATRDSRYALTVTQIIQIAIPASIIALVFLGSCICFIHRC QRRYRRSRRPIYSPQMPTGISCAVNEAAMARLGAELKSHPSTPPKSRRRSSRTPMPSLTAI AEESEPAGAAGLPTPPVDPTTPTPTPPLLV

> зр | P10211 | GB_HHV11 Гликопротеин оболочки B OS = Вирус герпеса человека 1 (штамм 17) OX = 10299 GN = gB PE = 1 SV = 1 MRQGAPARGRRWFVVWALLGLTLGVLVASAAPSSPGTPGVAAATQAANGGPATPAPP APGAPPKPTGDPKP AGDNATVAAGHATLREHLRDIKAENTDANFYV

CPPPTGATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFKATMYYKDVTVSQV WFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRSTAKYVRNNLETTAFHRDDHETD MELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVL ATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTT PKFTVAWDWVPKRPSVCTMTKWQEVDEMLRSEYGGSFRFSSDAISTTFTTNLTEYPLSR VDLGDCIGKDARDAMDRIFARRYNATHIKVGQPQYYLANGGFLIAYQPLLSNTLAELYV REHLREQSRKPPNPTPPPPGASANASVERIKTTSSIEFARLQFTYNHIQRHVNDMLGRVAI AWCELQNHELTLWNEARKLNPNAIASATVGRRVSARMLGDVMAVSTCVPVAADNVIV QNSMRISSRPGACYSRPLVSFRYEDQGPLVEGQLGENNELRLTRDAIEPCTVGHRRYFTF GGGYVYFEEYAYSHQLSRADITTVSTFIDLNITMLEDHEFVPLEVYTRHEIKDSGLLDYT EVQRRNQLHDLRFADIDTVIHADANAAMFAGLGAFFEGMGDLGRAVGKVVMGIVGGV VSAVSGVSSFMSNPFGALAVGLLVLAGLAAAFFAFRYVMRLQSNPMKALYPLTTKELK NPTNPDASGEGEEGGDFDEAKLAEAREMIRYMALVSAMERTEHKAKKKGTSALLSAKV TDMVMRKRRNTNYTQVPNKDGDADEDDL

> зр | P10185 | GL_HHV11 Конверт гликопротеин л ОС = Человеческий вирус герпеса 1 (штамм 17) ОХ = 10299 Г.Н. = Gl РЕ = 1 SV = 1 MGILGWVGLIAVGVLCVRGGLPSTEYVIRSRVAR EVGDILKVPCVPLPSDDLDWRYETP SAINYALIDGIFLRYHCPGLDTVLWDRHAQKAYWVNPFLFVAGFLEDLSYPAFPANTQE TETRLALYKEIRQALDSRKQAASHTPVKAGCVNFDYSRTRRCVGRQDLGPTNGTSGRTP VLPPDDEAGLQPKPLTTPPPIIATSDPTPRRDAATKSRRRRPHSRRL

> зр | Q69091 | GD_HHV11 Конверт гликопротеин D ОС = Человеческий вирус герпеса 1 (штамм 17) ОХ = 10299 Г.Н. = Gd РЕ = 1 SV = 1 MGGAAARLGAVILFVVIVGLHGVRSKYALVDASLKMADPNRFRGKDLPVLDQLTDPPG VRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPY NLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFL MHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGV TVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDP EDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNMGLIAGAVGGSLLAALVIC GIVYWMRRHTQKAPKRIRLPHIREDDQPSSHQPLFY

> зр | P68331 | GK_HHV11 Конверт гликопротеин К ОС = Человеческий вирус герпеса 1 (штамм 17) ОХ = 10299 Г.Н. = дК РЕ = 1 SV = 1 MLAVRSLQHLSTVVLITAYGLVLVWYTVFGASPLHRCIYAVRPTGTNNDTALVWMKM NQTLLFLGAPTHPPNGGWRNHAHICYANLIAGRVVPFQVPPDAMNRRIMNVHEAVNCL ETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVSPAHKMVAPATYLLNYAGRI VSS VFLQYPYTKITRLLCELSVQRQNLVQLFETDPVTFLYHRPAIGVIVGCELMLRFVAVGLI VGTAFISRGACAITYPLFLTITTWCFVSTIGLTELYCILRRGPAPKNADKAAAPGRSKGLS GVCGRCCSIILSGIAVRLCYIAVVAGVVLVALHYEQEIQRRLFDV

+

> зр | P10228 | GC_HHV11 Конверт гликопротеин С ОС = Человеческий вирус герпеса 1 (штамм 17) ОХ = 10299 Г.Н. = дс РЕ = 1 SV = 1 MAPGRVGLAVVLWSLLWLGAGVSGGSETASTGPTITAGAVTNASEAPTSGSPGSAASPE VTPTSTPNPNNVTQNKTTPTEPASPPTTPKPTSTPKSPPTSTPDPKPKNNTTPAKSGRPTKP PGPVWCDRRDPLARYGSRVQIRCRFRNSTRMEFRLQIWRYSMGPSPPIAPAPDLEEVLTN ITAPPGGLLVYDSAPNLTDPHVLWAEGAGPGADPPLYSVTGPLPTQRLIIGEVTPATQGM YYLAWGRMDSPHEYGTWVRVRMFRPPSLTLQPHAVMEGQPFKATCTAAAYYPRNPVE FVWFEDDHQVFNPGQIDTQTHEHPDGFTTVSTVTSEAVGGQVPPRTFTCQMTWHRDSV TFSRRNATGLALVLPRPTITMEFGVRIVVCTAGCVPEGVTFAWFLGDDPSPAAKSAVTA QESCDHPGLATVRSTLPISYDYSEYICRLTGYPAGIPVLEHHGSHQPPPRDPTERQVIEAIE WVGIGIGVLAAGVLVVTAIVYVVRTSQSRQRHRR

3.2. Прогнозирование антигенности и анализ физико-химических свойств белковых последовательностей

Из выбранных девяти белков для конструирования вакцины были отобраны только антигенные белки. Для определения антигенности использовался сервер VaxiJen v2.0 (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.htm). Среди девяти белков гликопротеин E оболочки, гликопротеин оболочки B и гликопротеин D оболочки были определены сервером как возможные антигенные белки (, таблица 01, ).Для этих трех белков был проведен анализ физико-химических свойств.

Таблица 01.

Определение антигенности девяти выбранных белков.

Физико-химическое исследование показало, что гликопротеин B оболочки имел наивысший коэффициент экстинкции 105255 M -1 см -1 и наименьшее значение GRAVY -0,403. Однако все три белка показали нестабильность, и все они имели период полураспада 30 часов в системе культивирования клеток млекопитающих. Результаты анализа физико-химических свойств перечислены в таблице 02 .

Таблица 02.

Анализ антигенности и физико-химических свойств выбранных вирусных белков.

3.3. Прогнозирование Т-клеточных и В-клеточных эпитопов и определение топологии эпитопов

Т-клеточные эпитопы MHC класса I трех белков определяли методом прогнозирования NetMHCpan EL 4.0 IEDB (https: //www.iedb .org /), сохраняя длину последовательности 09. Сервер выдал более 100 таких эпитопов. Однако на основе анализа лучших оценок антигенности (AS) и показателей процентилей для каждого эпитопа десять потенциальных эпитопов были случайным образом выбраны для проведения тестов на антигенность, аллергенность, токсичность и консервативность.Сервер ранжирует предсказанные эпитопы в порядке возрастания процентилей. Чем ниже процентиль, тем лучше сродство связывания. Т-клеточные эпитопы белков MHC класса II (аллель HLA DRB1 * 04-01) также определялись сервером IEDB (https://www.iedb.org/), на котором использовался метод предсказания Стурниоло. Среди сотен эпитопов, сгенерированных сервером, были отобраны десять лучших эпитопов для дальнейшего анализа. Более того, B-клеточные эпитопы белков были отобраны с использованием метода предсказания двупонных линейных эпитопов IEDB (https: // www.iedb.org/) и эпитопы были выбраны на основе их большей длины ( Рисунок 02 ). Топология выбранных эпитопов определялась сервером TMHMM v2.0 (http://www.cbs.dtu.dk/services/TMHMM/). Таблица 03 и Таблица 04 перечисляет потенциальные Т-клеточные эпитопы белка оболочки E, Таблица 05 и Таблица 06 перечисляет потенциальные Т-клеточные эпитопы гликопротеина оболочки B, Таблица 07 и Таблица 08 перечисляет потенциальные Т-клеточные эпитопы белка оболочки D и Таблица 09 перечисляет потенциальные В-клеточные эпитопы с их соответствующими топологиями.

Рисунок 02.

Рисунок, показывающий графики предсказания В-клеточного эпитопа для трех выбранных белков вируса простого герпеса человека-1, штамм-17, с использованием метода предсказания двуногих линейных эпитопов. Здесь (а) представляет собой график предсказания эпитопа для белка оболочки E, (b) представляет собой график предсказания эпитопа для гликопротеина оболочки B и (c) представляет собой график предсказания эпитопа для белка оболочки D.

Таблица 03.

MHC Предсказание и топология эпитопа класса I, анализ антигенности, аллергенности, токсичности и консервативности эпитопов гликопротеина оболочки E.

Таблица 04. Прогнозирование и топология эпитопа

MHC класса II, анализ антигенности, аллергенности, токсичности и консервативности эпитопов белка оболочки E.

Таблица 05.

Прогнозирование эпитопа MHC класса I и топология, антигенность, аллергенность, токсичность и анализ консервативности эпитопов белка оболочки B.

Таблица 06. Прогнозирование и топология эпитопа

MHC класса II, анализ антигенности, аллергенности, токсичности и консервативности эпитопов белка оболочки B.

Таблица 07. Прогнозирование и топология эпитопа

MHC класса I, анализ антигенности, аллергенности, токсичности и консервативности эпитопов белка оболочки D.

Таблица 08.

Прогнозирование эпитопа MHC класса II и топология, антигенность, аллергенность, токсичность и анализ консервативности эпитопов белка оболочки D.

Таблица 09.

Прогнозирование эпитопа В-клеток и анализ антигенности и аллергенности эпитопов трех выбранных белков.

3.4. Анализ антигенности, аллергенности, токсичности и консервативности

При анализе антигенности, аллергенности, токсичности и консервативности эпитопы Т-клеток, которые оказались высоко антигенными, а также неаллергенными, нетоксичными, имели минимальную идентичность более 50 % и имели консервативность более 90%, и антигенные, а также неаллергенные В-клеточные эпитопы были отобраны для дальнейшего анализа и создания вакцины.Среди десяти выбранных эпитопов MHC класса I и десяти выбранных эпитопов MHC класса II гликопротеина E оболочки было отобрано шесть эпитопов (по три эпитопа из каждой категории) на основе упомянутых критериев: YTLSVGDIK, ITISTAAQY, AVKSRASGK, VRMETPEAILFS, LRFDVPTSCAEM и PSWVSLMPPKQV. С другой стороны, среди десяти выбранных эпитопов MHC класса I и десяти выбранных эпитопов MHC класса II гликопротеина B оболочки, всего шесть эпитопов (по три эпитопа из каждой категории) были отобраны на основе упомянутых критериев: KVTDMVMRK, YAYSHQLSR , ASANASVER, TMYYKDVTVSQV, YARDLTTKARAT и VMRLQSNPMKAL.Более того, как и эти белки, шесть эпитопов, которые подчинялись указанным критериям, были отобраны для дальнейшего анализа из эпитопов гликопротеина D оболочки: KMADPNRFR, KIAGWHGPK, SIQDAATPY, QAYQQGVTVDSI, YWMRRHTQKAPK и VLLNAPSEAPQI. Для отбора эпитопов В-клеток были взяты высокоантигенные и неаллергенные последовательности для конструирования вакцины. Были отобраны по три эпитопа из каждой категории белков. По этой причине для конструирования вакцины были отобраны всего девять эпитопов В-клеточных эпитопов, поскольку они подчинялись критериям отбора.( Таблица 03 , Таблица 04 , Таблица 05 , Таблица 06 , Таблица 07 , Таблица 08 и Таблица 09 ).

3.5. Кластерный анализ аллелей MHC

Кластерный анализ возможных аллелей MHC класса I и MHC класса II, которые могут взаимодействовать с предсказанными эпитопами трех выбранных белков, был выполнен онлайн-инструментом MHCcluster 2.0 (http: // www. .cbs.dtu.dk / services / MHCcluster /). Инструмент генерирует взаимосвязь кластеров аллелей филогенетическим способом. На рисунке 03 показан результат эксперимента, где красная зона указывает на сильное взаимодействие, а желтая зона соответствует более слабому взаимодействию.

Рисунок 03.

Результаты кластерного анализа MHC. Здесь (a) — тепловая карта (слева) и древовидная карта (справа) кластерного анализа MHC класса I, (b) — тепловая карта (слева) и древовидная карта (справа) кластера MHC класса II. анализ. Кластерный анализ проводился с использованием онлайн-сервера MHCcluster 2.0 (http: //www.cbs.dtu.dk / services / MHCcluster /).

Рисунок 04.

Рисунок, показывающий взаимодействия между лучшими эпитопами из трех белков и их соответствующими рецепторами. Здесь (a) — взаимодействие между YTLSVGDIK и MHC класса-I, (b) — это взаимодействие между ASANASVER и MHC класса-I, (c) — это взаимодействие между KIAGWHGPK и молекулой MHC класса-I, (d) — это взаимодействие между PSWVSLMPPKQV и MHC класса-II, (e) — взаимодействие между TMYYKDVTVSQV и MHC class-II, (f) — взаимодействие между QAYQQGVTVDSI и молекулой MHC класса-II.Взаимодействия визуализировались с помощью Discovery Studio Visualizer.

3.6. Создание трехмерных структур эпитопов и стыковка пептид-белок

Трехмерные структуры выбранных Т-клеточных эпитопов были созданы сервером PEP-FOLD3. Трехмерные структуры были созданы для стыковки пептид-белок. Докинг проводили, чтобы выяснить, все ли эпитопы обладают способностью связываться с молекулами MHC класса I и MHC класса II. Все эпитопы MHC класса I были состыкованы против аллеля HLA-A * 11-01 (PDB ID: 5WJL) и MHC класса II HLA DRB1 * 04-01 (PDB ID: 5JLZ).Стыковка была выполнена с использованием сервера PatchDock, а затем результаты были уточнены онлайн-сервером FireDock. Среди эпитопов MHC класса I гликопротеина E оболочки YTLSVGDIK показал лучший результат с самой низкой глобальной энергией -41,93. Среди эпитопов MHC класса I гликопротеина B оболочки ASANASVER показал самую низкую и лучшую глобальную энергетическую оценку -36,46. KIAGWHGPK генерировал лучший глобальный энергетический балл -41,47 для эпитопов MHC класса I гликопротеина оболочки D. Среди эпитопов MHC класса II гликопротеина E оболочки PSWVSLMPPKQV генерировал лучший глобальный энергетический балл -7.76. TMYYKDVTVSQV генерировал самую низкую глобальную энергию -54,94, а QAYQQGVTVDSI генерировал самую низкую глобальную энергию -4,25 среди эпитопов MHC класса II гликопротеина оболочки B и гликопротеина оболочки D, соответственно (, таблица 10, ).

Таблица 10.

Результаты молекулярного стыковочного анализа выбранных эпитопов.

3,7. Конструирование вакцины

После успешной стыковки были сконструированы три вакцины, которые можно было эффективно использовать для борьбы с HSV-1, штаммом-17.Для создания вакцины использовали три различных адъюванта для создания трех разных вакцин для каждого из вирусов: использовали бета-дефенсин, рибосомный белок L7 / L12 и белок HABA. Эти три вакцины отличаются друг от друга только своими адъювантными последовательностями. Последовательность PADRE также использовалась для создания вакцины. Три разные конструкции вакцины отличались друг от друга только своими адъювантными последовательностями. Во время конструирования вакцины линкеры EAAAK, GGGS, GPGPG и KK использовали в их требуемых положениях.Каждая конструкция вакцины оканчивалась дополнительным линкером GGGS. Вновь сконструированные вакцины были обозначены как: HV-1, HV-2 и HV-3 (, таблица 11, ).

Таблица 11.

Список вакцин, сконструированных против вируса простого герпеса-1, штамм-17.

3.8. Анализ антигенности, аллергенности и физико-химических свойств вакцинных конструкций

Было обнаружено, что три вакцины являются сильнодействующими антигенами, а также неаллергенами. Поскольку они не вызывают аллергии, они безопасны в использовании.При анализе физико-химических свойств определяли количество аминокислот, молекулярную массу, коэффициент экстинкции (в M-1 см-1), теоретический pI, период полураспада, алифатический индекс и GRAVY. Все вакцины довольно похожи теоретически pI и ext. коэффициент (у HV-3 самое низкое значение 74566,83 М-1 см-1). У всех вакцинных конструкций период полужизни в клетках млекопитающих составлял 1 час. HV-2 имел наивысшее значение GRAVY -0,544. Анализ антигенности, аллергенности и физико-химических свойств трех вакцинных конструкций приведен в , Таблица 12, .

Таблица 12.

Анализ антигенности, аллергенности и физико-химических свойств трех вакцинных конструкций.

3.9. Прогнозирование вторичной и третичной структуры вакцинных конструкций

Вторичные структуры трех вакцинных конструкций были созданы с помощью онлайн-инструментов PRISPRED (http://bioinf.cs.ucl.ac.uk/psipred/) и NetTurnP v1.0 (http://www.cbs.dtu.dk/services/NetTurnP/). Анализ вторичной структуры показал, что HV-1 имеет самый высокий процент аминокислот (74.1%) в формировании клубка, а также самый высокий процент аминокислот (10,8%) в образовании бета-цепи. Однако HV-3 имел самый высокий процент 30,1% аминокислот в образовании альфа-спирали ( фиг. 05 и таблица 13 ).

Рисунок 05.

Результаты предсказания вторичной структуры сконструированных вакцин против герпеса. Здесь (a) — HV-1, (b) — HV-2, (c) — HV-3. Вторичные структуры были предсказаны с помощью онлайн-сервера PRISPRED (http: //bioinf.cs.ucl.ac.uk/psipred/).

Таблица 13.

Результаты анализа вторичной структуры вакцинных конструкций.

Трехмерные структуры вакцинных конструкций были предсказаны онлайн-сервером RaptorX (http://raptorx.uchicago.edu/). Все три вакцины имели 3 домена, а HV-2 имел самое низкое значение p 8,91e-05. Моделирование гомологии трех вакцинных конструкций против денге проводили с использованием 1KJ6A (для HV-1), 1DD3A (для HV-2) и 4TQLA (для HV-3) в качестве шаблонов из банка данных по белкам (https: // www.rcsb.org/). Результаты анализа трехмерной структуры перечислены в , таблица 14, и проиллюстрированы на , фиг. 06, .

Рисунок 06.

Третичные структуры трех вакцин против герпеса. Здесь (a) — HV-1, (b) — HV-2 и (c) — HV-3. Третичные структуры были предсказаны с помощью онлайн-серверного инструмента RaptorX (http://raptorx.uchicago.edu/) и визуализированы с помощью Discovery Studio Visualizer.

Таблица 14.

Результаты анализа третичной структуры вакцинных конструкций.

3.10. Уточнение и проверка трехмерной структуры белка

Белковые структуры, созданные сервером RaptorX (http://raptorx.uchicago.edu/), были уточнены с помощью 3Drefine (http://sysbio.rnet.missouri.edu/3Drefine/), а затем уточненные структуры были проанализированы графиком Рамачандрана, созданным сервером PROCHECK (https://servicesn.mbi.ucla.edu/PROCHECK/). Анализ показал, что вакцина против HV-1 содержала 63,9% аминокислот в наиболее предпочтительной области, 30,6% аминокислот в дополнительных разрешенных областях 3.7% аминокислот в разрешенных областях и 1,8% аминокислот в запрещенных областях. Вакцина против HV-2 содержала 70,4% аминокислот в наиболее благоприятных областях, 26,2% аминокислот в дополнительных разрешенных областях, 2,9% аминокислот в разрешенных областях и 0,5% аминокислот в запрещенные регионы. Вакцина против HV-3 содержала 74,7% аминокислот в наиболее благоприятных областях, 23,7% аминокислот в дополнительных разрешенных областях, 1,1% аминокислот в разрешенных областях и 0.5% аминокислот в запрещенных областях ( Рисунок 07 ).

3.11. Protein Disulfide Engineering

При разработке дисульфидных белков дисульфидные связи были созданы для трехмерных структур вакцинных конструкций. Сервер DbD2 определяет пары аминокислот, способных образовывать дисульфидные связи, на основе заданных критериев выбора. В этом эксперименте мы выбрали только те пары аминокислот, у которых значение энергии связи было меньше 2.00 ккал / моль. HV-1 генерировал 12 пар аминокислот, способных образовывать дисульфидные связи. Однако были выбраны только 4 пары, поскольку они имели энергию связи менее 2,00 ккал / моль: 19 Arg и 148 Gly, 21 Gly и 47 Arg, 177 Val и 162 Gly, 233 Pro и 251 Ser. HV-2 генерировал 21 пару аминокислот, которые обладали способностью образовывать дисульфидные связи, однако было выбрано только 6 пар: 60 Glu и 67 Glu, 68 Phe и 118 Ala, 174 Ser и 217 Ser, 275 Gly и 319 Lys, 314 Ser и 325 Pro, 360 Gly и 369 Met.HV-3 генерировал 15 пар аминокислот, способных образовывать дисульфидные связи, и были выбраны только 3 пары аминокислот: 191 Val и 248 Gly, 253 Ser и 290 Ser, 255 Asn и 282 Trp. Выбранные пары аминокислот сформировали мутантную версию исходных вакцин на сервере DbD2 (, фиг. 08, ).

Рисунок 08.

Показаны дисульфидная инженерия трех вакцинных конструкций, как исходной (слева), так и мутантной (справа) формы. Здесь (а) HV-1, (b) HV-2, (c) HV-3. Инжиниринг дисульфидов проводился с использованием онлайн-инструмента DbD2 server (http: // cptweb.cpt.wayne.edu/DbD2/).

Рисунок 09.

Рисунок, показывающий взаимодействие между TLR-3 и выбранной вакциной HV-1. Взаимодействие визуализировалось с помощью инструмента PyMol. Здесь лиганды обозначены розовым цветом, а рецептор обозначен зеленым цветом.

3.12. Исследование стыковки «белок-белок»

Исследование стыковки «белок-белок» было проведено с целью определения наилучшей созданной вакцины от герпеса. На основе анализа стыковки белок-белок было заявлено, что HV-1 была лучшей вакциной с лучшими и самыми низкими баллами в исследовании MM-GBSA и исследовании HawkDock.Однако при анализе с помощью ClusPro 2.0 и последующем уточнении и повторной оценке с помощью инструмента PRODIGY сервера HADDOCK HV-1 показал наилучшую аффинность связывания, ΔG баллы с DRB3 * 0202 (-17,1 ккал / моль), DRB3 * 0101 (- 19,2 ккал / моль), DRB1 * 0401 (-21,2 ккал / моль) и TLR-3 (-21,9 ккал / моль). И при анализе серверами PatchDock и FireDock HV-1 показал лучшие глобальные показатели энергии с тремя аллелями MHC: DRB5 * 0101 (-18,12), DRB1 * 0401 (-32,33), DRB1 * 0301 (-13,32) и TLR-3 ( -10,66). Поскольку HV-1 показал превосходные результаты в исследовании стыковки белок-белок, он считался лучшей конструкцией вакцины среди трех сконструированных вакцин (, таблица 15, ).Моделирование молекулярной динамики и исследования адаптации кодонов in silico проводились только на вакцине HV-1.

Таблица 15.

Результаты исследования стыковки всех вакцинных конструкций.

3.13. Моделирование молекулярной динамики

На рисунке 10 показаны результаты моделирования молекулярной динамики и анализа в нормальном режиме (NMA) стыкованного комплекса HV-1-TLR-3. График деформируемости комплекса показывает пики на графиках, которые соответствуют областям белка с возможной деформируемостью (, фиг. 10b, ).График B-фактора комплекса дает легкую визуализацию разницы, а также сравнение между NMA и полем PDB пристыкованного комплекса ( Рисунок 10c) . Собственное значение комплекса показано на Рис. 10d . Пристыкованный комплекс HV-1 и TLR-3 сгенерировал собственное значение 1.042621e-04. График дисперсии показывает индивидуальную дисперсию красными полосами и кумулятивную дисперсию зелеными полосами (, рисунок 10e, ). На фиг. 10f показана карта ковариации комплекса, где коррелированное движение между парой остатков обозначено красным цветом, некоррелированное движение обозначено белым цветом, а антикоррелированное движение обозначено синим цветом.Карта упругости комплекса представляет собой связь между атомами, а более темные серые области соответствуют более жестким областям ( Рисунок 10g ) [67, 68, 69].

Рисунок 10.

Рисунок, отображающий результаты моделирования молекулярной динамики стыкованного комплекса HV-1 и TLR-3. Здесь (a) подвижность NMA, (b) деформируемость, (c) B-фактор, (d) собственные значения, (e) дисперсия (красный цвет указывает на индивидуальную дисперсию, а зеленый цвет указывает на совокупную дисперсию), (f) карта ковариации (коррелированные (красный), некоррелированные (белые) или антикоррелированные (синие) движения) и (ж) эластичная сеть (более темные серые области указывают на более жесткие области).

3.14. Адаптация кодонов и клонирование in silico

Для клонирования in silico и конструирования плазмид белковые последовательности лучших отобранных вакцин были адаптированы сервером JCat (http://www.jcat.de/).

Поскольку белок HV-1 имеет 600 аминокислот, после обратной трансляции количество нуклеотидов вероятной последовательности ДНК HV-1 будет 1800. Значение индекса адаптации кодонов (CAI) 0,973 для HV-1 указывает на то, что последовательности ДНК содержат более высокую долю кодонов, которые с наибольшей вероятностью будут использоваться в клеточном аппарате организма-мишени E.coli штамм K12 (смещение кодонов). По этой причине производство вакцины HV-1 будет осуществляться эффективно [74, 75]. Содержание улучшенной последовательности по ГХ составляло 56,33%. Предсказанная последовательность ДНК HV-1 была вставлена ​​в векторную плазмиду pET-19b между сайтами рестрикции SgrAI и SphI. Поскольку последовательность ДНК не имела сайтов рестрикции для ферментов рестрикции SgrAI и SphI, сайты рестрикции SgrA1 и SphI были конъюгированы на N-концевом и C-концевом сайтах, соответственно, перед вставкой последовательности в вектор плазмиды pET-19b.Вновь сконструированная клонированная плазмида будет иметь длину 7372 пары оснований, включая сконструированную последовательность ДНК вакцины против HV-1 (последовательность ДНК вакцины против HV-1 также включает сайты рестрикции SgrAI и SphI) ( фигура 11 и фигура 12 ).

Рисунок 11.

Рисунок, показывающий графики адаптации кодонов вакцины HV-1. Кодоновую адаптацию вакцинных конструкций проводили с использованием сервера JCat (https://jcatbeauty.com/).

Фигура 12.

Рестрикционное клонирование in silico последовательности вакцины HV-1 в плазмиде pET-19b между сайтами рестрикционного фермента SgrAI и SphI.Участки, отмеченные красным цветом, содержат ДНК-вставки вакцин. Клонирование проводилось с помощью инструмента SnapGene. Две недавно сконструированные плазмиды могут быть вставлены в штамм E. coli K12 для эффективного производства вакцины.

4. Обсуждение

Вакцина — один из наиболее важных и широко производимых фармацевтических продуктов. Ежегодно миллионы людей и младенцев получают вакцинацию. Однако процессы исследования и разработки вакцин являются дорогостоящими, и иногда требуется много лет, чтобы разработать подходящую вакцину-кандидат против конкретного патогена.В последнее время для разработки вакцины используются различные методы и инструменты биоинформатики, иммуноинформатики и обратной вакцинологии, что экономит время и затраты на процесс разработки вакцины [76].

Настоящее исследование было проведено с целью разработки и создания потенциальной вакцины против вируса простого герпеса (ВПГ), штамм-17. Целевой вирус и его штамм были идентифицированы путем просмотра базы данных NCBI (https://www.ncbi.nlm.nih.gov/). Девять гликопротеинов оболочки были выбраны в качестве мишеней для создания вакцины: гликопротеин оболочки M, гликопротеин оболочки H, гликопротеин оболочки I, гликопротеин оболочки E, гликопротеин оболочки B, гликопротеин оболочки L, гликопротеин оболочки D, гликопротеин оболочки K и гликопротеин оболочки C.Гликопротеин М оболочки играет важную роль в сборке вирусов [77]. Гликопротеин H оболочки образует гетеродимер с гликопротеином L оболочки, и оба гликопротеина оболочки участвуют в проникновении вируса в клетку-хозяина. Более того, гликопротеин оболочки B вместе с гликопротеином оболочки H и гликопротеином оболочки K помогает в событиях слияния оболочки вириона с внешней ядерной мембраной [78, 79, 80]. Основными функциями гликопротеина E оболочки и гликопротеина I оболочки являются распространение вируса от клетки к клетке, а также слияние клеток [81, 82, 83].Гликопротеин D оболочки также помогает вирусу проникать в хозяйскую клетку [84]. Гликопротеин С оболочки способствует адсорбции вириона на поверхность клетки-хозяина [85]. Поскольку гликопротеины в основном действуют в инфекционном процессе HSV, по этой причине нацеливание на эти гликопротеины может быть потенциальной стратегией для создания вакцины.

После выбора белков антигенность белков определялась сервером VaxiJen V2.0. Белки, которые оказались антигенными, были отобраны для дальнейшего анализа.Три гликопротеина, гликопротеин E оболочки, гликопротеин B оболочки и гликопротеин D оболочки были признаны антигенными, и по этой причине они были отобраны для дальнейшего анализа. Различные физико-химические свойства, такие как количество аминокислот, молекулярная масса, теоретическая pI, коэффициент экстинкции, индекс нестабильности, алифатический индекс, GRAVY, были определены сервером ProtParam (https://web.expasy.org/protparam/). В тесте на физико-химические свойства все три белка показали себя примерно одинаково.

Две из основных клеток, которые функционируют в иммунитете, — это Т-лимфоцитарная клетка и В-лимфоцитарная клетка. После распознавания антигенпрезентирующей клеткой или APC (например, макрофагом, дендритной клеткой и т. Д.) Антиген презентируется через молекулу MHC класса II, присутствующую на поверхности APC, к хелперной Т-клетке. Поскольку Т-хелперная Т-клетка содержит молекулу CD4 + на своей поверхности, она также известна как Т-лимфоцит CD4 +. После активации антигенпрезентирующей клеткой, Т-хелперная клетка затем активирует В-клетку и вызывает производство В-клеток памяти и плазматических В-клеток, продуцирующих антитела.Плазменные В-клетки продуцируют большое количество антител, а В-клетки памяти функционируют как иммунологическая память. Однако макрофаги и цитотоксические Т-клетки CD8 + также активируются Т-хелперами, которые разрушают антиген-мишень [86, 87, 88, 89, 90]. Возможные Т-клеточные и В-клеточные эпитопы выбранных вирусных белков были определены сервером IEDB (https://www.iedb.org/). Сервер IEDB генерирует и ранжирует эпитопы Т-клеток на основе их оценок антигенности (AS) и процентилей.Для анализа были взяты первые десять эпитопов MHC класса I. Однако, поскольку более чем один эпитоп показал сходную оценку AS и процентиль, было выбрано по два эпитопа из каждой из категорий оценки AS и процентиля. Однако на основе анализа длины эпитопов В-клеток было отобрано пять эпитопов для дальнейшего анализа. Трансмембранная топология выбранных эиптопов была предсказана, чтобы определить, будут ли они присутствовать снаружи или внутри вирусной оболочки.

Антигенность определяется как способность чужеродного вещества действовать как антиген и активировать Т-клеточные и В-клеточные ответы через их антигенную детерминантную часть или эпитоп [91].Аллергенность вещества определяется как способность этого вещества действовать как аллерген и вызывать потенциальные аллергические реакции в организме [92]. С другой стороны, при разработке вакцины эпитопы, которые остаются консервативными для различных штаммов, имеют больший приоритет, чем геномные области, которые сильно варьируют среди штаммов, поскольку консервативные эпитопы белка (ов) обеспечивают более широкую защиту для различных штаммов, а иногда и даже виды [93]. При выборе лучших эпитопов для создания вакцины соблюдались некоторые критерии: эпитопы должны быть высокоантигенными, чтобы они могли вызывать высокий антигенный ответ, эпитопы должны быть неаллергенными по своей природе, по этой причине они не смогут вызвать у человека любую аллергическую реакцию, и эпитопы не должны быть токсичными.Эпитопы со 100% консервативностью и минимальной идентичностью более 50% были отобраны для конструирования вакцины, чтобы консервативные эпитопы могли обеспечивать защиту от различных штаммов. Анализ консервативности эпитопов проводили с использованием штамма F вируса простого герпеса человека-1 и штамма HG52 вируса простого герпеса человека-2 для сравнения, чтобы можно было эффективно провести анализ консервативности по штаммам, а также по видам. . Всего 18 Т-клеточных эпитопов (шесть эпитопов от каждого из белков) и 9 В-клеточных эпитопов были отобраны для конструирования вакцины.Более того, кластерный анализ аллелей MHC класса I и аллелей MHC класса II также был проведен для определения их взаимосвязи друг с другом и их функциональной кластеризации на основе их предсказанной специфичности связывания [94].

На следующем этапе белок-пептидный стыковку выполняли между выбранными эпитопами и аллелями MHC. Эпитопы MHC класса I стыковались с молекулой MHC класса I (PDB ID: 5WJL), а эпитопы MHC класса II стыковались с молекулой MHC класса II (PDB ID: 5JLZ).Связывание белок-пептид выполняли для определения способности эпитопов связываться с их соответствующей молекулой MHC. После создания трехмерной структуры эпитопов стыковка была произведена серверами PatchDock и FireDock. YTLSVGDIK, ASANASVER, KIAGWHGPK, PSWVSLMPPKQV, TMYYKDVTVSQV и QAYQQGVTVDSI получили лучшие результаты в стыковке белок-пептид. Однако все выбранные Т-клеточные эпитопы показали значительную способность к взаимодействию со своими соответствующими мишенями.

После успешного стыковки белок-пептид была проведена процедура конструирования вакцины.Были сконструированы три разные вакцины, которые отличаются друг от друга на основе их адъювантных последовательностей. Три конструкции вакцины были обозначены как: HV-1 (длина 600 аминокислот), HV-2 (длина 685 аминокислот) и HV-3 (длина 714 аминокислот).

После создания вакцины был проведен анализ антигенности, аллергенности и физико-химических свойств. Доказано, что все конструкции вакцины являются антигенными, а также неаллергенными, по этой причине они не должны вызывать аллергическую реакцию в организме, однако все они должны быть способны вызывать высокий иммуногенный ответ.Коэффициент экстинкции соответствует количеству света, поглощаемого соединением на определенной длине волны [95, 96]. HV-3 имел самый высокий коэффициент экстинкции 74566,83 М-1 см-1. Алифатический индекс белка относится к относительному объему, занимаемому алифатическими аминокислотами в боковых цепях, таких как аланин, валин и т. Д. [97]. HV-2 имел самый высокий алифатический индекс среди вакцинных конструкций, хотя HV-3 имел алифатический индекс, очень близкий к алифатическому индексу HV-2. Все три конструкции вакцины имели аналогичный период полужизни, равный 1 часу, в культуре клеток млекопитающих, и все они были стабильными.Все конструкции имели примерно одинаковые теоретические значения pI. Совершенно аналогичные характеристики наблюдались у трех вакцинных конструкций при анализе физико-химических свойств.

Два онлайн-сервера, PRISPRED (http://bioinf.cs.ucl.ac.uk/psipred/) и NetTurnP v1.0 (http://www.cbs.dtu.dk/services/NetTurnP/), были используется для определения вторичной структуры белков. HV-3 имел самый высокий процент аминокислот в образовании альфа и самый низкий процент аминокислот в образовании бета-листа, а также в образовании спиральной структуры.Трехмерные структуры были сгенерированы сервером RaptorX (http://raptorx.uchicago.edu/), и с самым низким значением p 8.91e-05 HV-2 показал лучшую производительность при создании трехмерных структур белка. Однако все белки имели 3 домена. После создания трехмерной структуры трехмерные структуры были уточнены онлайн-инструментом 3Drefine (http://sysbio.rnet.missouri.edu/3Drefine/) и подтверждены PROCHECK (https://servicesn.mbi.ucla.edu/PROCHECK/) сервер. HV-3 показал лучшие характеристики в исследовании уточнения и валидации трехмерной конструкции с 74 баллами.7% аминокислот в наиболее предпочтительных областях и 23,7% аминокислот в дополнительных разрешенных областях. После проверки трехмерных белковых структур дисульфидная инженерия вакцинных конструкций была выполнена с использованием сервера Disulfide by Design 2 v12.2 (http://cptweb.cpt.wayne.edu/DbD2/) и пар аминокислот с энергией связывания. значение менее 2,0 ккал / моль, было выбрано для образования дисульфидной связи. С шестью парами аминокислот с энергией связывания менее 2,0 ккал / моль можно считать, что HV-2 показал лучшие характеристики в инженерных исследованиях дисульфидных белков.

На следующем этапе проводили стыковку белок-белок с использованием вакцинных конструкций в качестве лигандов и различных аллелей MHC в качестве рецепторов. Эксперимент по стыковке был проведен для определения лучшей конструкции вакцины среди трех вакцин. Все вакцины успешно связываются со своими рецепторами-мишенями. Однако в ходе эксперимента по стыковке выяснилось, что HV-1 была лучшей вакциной среди трех вакцинных конструкций. По этой причине конструкцию вакцины HV-1 использовали для моделирования молекулярной динамики и клонирования in silico.Исследование методом молекулярной динамики показало, что комплекс HV-1-TLR-3 имеет очень низкую вероятность деформируемости. Это было дополнительно подтверждено графиком деформируемости 10b, где пики на графиках редко достигают максимального значения. Собственное значение комплекса 1.042621e-04 также указывает на тот факт, что стыкованный комплекс HV-1-TLR-3 должен быть достаточно стабильным и иметь относительно меньшую вероятность деформируемости. Рисунок 10f иллюстрирует коррелированное движение пар аминокислотных остатков красным цветом, и, согласно рисунку, комплекс показал большое количество пар аминокислот в коррелированном движении.Наконец, вакцину против HV-1 подвергали обратной транскрипции в возможную последовательность ДНК для клонирования в штамм E. coli K12. Перед проведением процедуры клонирования in silico была проведена адаптация кодонов вакцины HV-1, при которой было достигнуто значение CAI 0,973, что отражает то, что недавно адаптированная последовательность имела высокую степень кодонов, которые, скорее всего, будут использоваться . E. coli штамм K12. Кроме того, также было достигнуто хорошее содержание ГХ 56,33%. Наконец, адаптированную последовательность ДНК вставляли в плазмиду pET-19b, и длина плазмиды со вставкой HV-1 составляла 7372 пары оснований.Эта вновь созданная плазмида с целевой последовательностью ДНК может быть вставлена ​​в штамм E. coli K12 для эффективного производства вакцины против HV-1.

Тем не менее, необходимо провести больше исследований in vitro и in vivo, чтобы окончательно подтвердить безопасность, эффективность и потенциал предполагаемых вакцин.

5. Заключение

Вирус простого герпеса — одно из самых инфекционных и венерических заболеваний в мире. Однако половым путем передается только ВПГ-2.Другой тип вируса герпеса, HSV-1, передается через орально-оральный контакт. При очень высоком уровне инфицирования HSV можно считать одним из смертельных вирусов в мире. Однако пока не найдено ни одной вакцины с удовлетворительными результатами для борьбы с инфекцией ВПГ. В этом исследовании возможная субъединичная вакцина для борьбы с HSV-1, штаммом-17, была разработана с использованием различных инструментов биоинформатики, иммуноинформатики и вакциномики. В этом исследовании впервые были идентифицированы потенциальные белки вирусной структуры.Затем с помощью надежных процессов идентифицировали потенциальные эпитопы, и эти эпитопы использовали для конструирования вакцины. Поскольку были отобраны только высокоантигенные и в то же время неаллергенные эпитопы, сконструированные вакцины должны вызывать очень сильный антигенный ответ, однако, не обладая аллергенностью, сконструированные вакцины должны быть безопасными для введения. Были сконструированы три возможные вакцины, и путем проведения экспериментов по стыковке была определена одна лучшая конструкция вакцины.Позже для крупномасштабного производства вакцин были выполнены моделирование молекулярной динамики и адаптация кодонов, а также клонирование in silico. Вакцина должна обеспечивать лучший иммунитет к HSV-1, штамму-17, а также к HSV-1, штамму-F и HSV-2, штамму-HG52, благодаря своей сохранности среди штаммов и видов. Тем не менее, необходимо провести влажные лабораторные исследования результатов этого эксперимента, чтобы окончательно подтвердить безопасность, эффективность и потенциальные возможности вакцинных конструкций.Надеюсь, это исследование вызовет интерес у ученых в соответствующей области.

Что такое HHV-6? | Фундамент ВТС-6 | Информация о заболевании HHV-6 для пациентов, клиницистов и исследователей

Вирус герпеса человека 6 (HHV-6) представляет собой набор из двух тесно связанных вирусов герпеса, известных как HHV-6A и HHV-6B. HHV-6B поражает почти 100% людей, как правило, в возрасте до трех лет и часто приводит к лихорадке, диарее, иногда с сыпью, известной как розеола. Эта начальная инфекция HHV-6B, хотя и редко, может вызывать фебрильные судороги, энцефалит или трудноизлечимые судороги.Мало что известно о распространенности HHV-6A или о том, как он передается, но одно небольшое исследование показало очень низкие уровни HHV-6A в слюне половины здоровых взрослых.

Как и другие герпесвирусы — вирус Эпштейна-Барра, ветряная оспа, простой герпес — HHV-6 создает латентный период в течение всей жизни и может реактивироваться в более позднем возрасте. Эта реактивация была связана со многими клиническими проявлениями, которые можно увидеть в разделе «Сопутствующие состояния» на этом сайте. Реактивация может происходить в головном мозге, легких, сердце, почках и желудочно-кишечном тракте, особенно у пациентов с иммунодефицитом и пациентов после трансплантации.В некоторых случаях реактивация HHV-6 в ткани мозга может вызвать когнитивную дисфункцию, необратимую инвалидность и смерть. За исключением острых или начальных инфекций, вирусную ДНК обычно можно обнаружить только с помощью биопсии, поскольку она не циркулирует в периферической крови.

Растущее число исследований также предполагает, что HHV-6 может играть роль в подгруппе пациентов с хроническими состояниями. HHV-6A недавно был обнаружен в матке женщин с бесплодием, в ткани щитовидной железы пациентов с тиреоидитом Хашимото и был предложен в качестве спускового механизма для подгруппы случаев рассеянного склероза и синдрома хронической усталости.Высокие уровни ДНК HHV-6B в биоптатах головного мозга пациентов с рефрактерной эпилепсией предполагают, что вирус может играть роль в подгруппе людей с этим заболеванием. HHV-6 также был связан с фебрильными припадками и эпилептическим статусом. Существует острая потребность в новых технологиях для обнаружения этих скрытых инфекций, которые не выявляются стандартными методами количественного анализа ДНК ПЦР, чтобы доказать или опровергнуть предложенные важные ассоциации с болезнями.

инфекций, вызванных вирусом герпеса, после трансплантации легких — проконсультируйтесь с QD

Атул Мехта, MD

Клиника Кливленда — некоммерческий академический медицинский центр.Реклама на нашем сайте помогает поддерживать нашу миссию. Мы не поддерживаем Политику в отношении продуктов или услуг, не принадлежащих Cleveland Clinic.

Поскольку трансплантация легких (LT) становится все более распространенной, пульмонологи должны знать о дерматологических осложнениях после трансплантации. В недавнем графическом обзоре, опубликованном в CHEST , мы с моими коллегами описываем патогенез, эпидемиологические характеристики и клинические проявления дерматологических осложнений, обнаруживаемых у реципиентов трансплантата легких.Здесь я остановлюсь на кожных проявлениях вируса герпеса (HV).

HV в LT получатели

Поскольку HV являются лимфотрофными, они легко распространяются у пациентов с ослабленным иммунитетом, таких как реципиенты LT. Другие факторы риска включают серопозитивный трансплантат серонегативному хозяину, отсутствие или устойчивость к противовирусной профилактике, реактивацию латентной инфекции и конденсацию двух HV. Кожные проявления чаще всего встречаются при HSV-1, HSV-2, ветряной оспе, HHV-6 и KSHV. Иммуномодулирующий эффект этих вирусов может повысить уязвимость к оппортунистическим инфекциям.

HSV-1 сероположен у 50-80 процентов взрослых реципиентов трансплантата и обычно проявляется во рту или на лице. Приведенные выше изображения показывают менее распространенную инфекцию HSV брюшной стенки и верхней части бедра у реципиентов трансплантата.

HSV-2 встречается реже и чаще всего вызывает поражения половых органов. HHV-6 A часто встречается у взрослых. HHV-6 B часто встречается у детей и вызывает наибольшую реактивацию у реципиентов трансплантата с частотой от 20 до 28 процентов.Распространенность серотипа составляет 100 процентов у взрослых и обычно реактивируется рано после трансплантации. Реактивация может протекать бессимптомно или быть связана с лихорадкой и кожными высыпаниями в виде эритематозных пятен и папул, окруженных белым ореолом. Высыпания энантемы — это пятна и язвы Нагаямы на язычке и небно-язычном соединении. Показатели коинфекции цитомегаловирусом высоки.

Опоясывающий лишай

Частота опоясывающего лишая у реципиентов трансплантата составляет от 3 до 25 процентов и чаще встречается у пожилых реципиентов грудных трансплантатов, получающих иммуносупрессивные схемы, содержащие микофенолят.У реципиентов легкого образование струпьев может быть более длительным процессом.

Пациенты с повышенным риском развития опоясывающего лишая и других инфекций, вызванных вирусом герпеса, должны регулярно проходить скрининг и информировать о важности наблюдения за кожей. Я призываю любого пульмонолога-трансплантолога включать консультирование, лечение, обучение и направление к соответствующим специалистам в свои визиты после трансплантации.

Доктор Мехта работает в отделении легочной медицины.

Изображения переизданы с разрешения CHEST.

Этапы инфекционного цикла вируса герпеса человека (HV). HV проникают в клетки …

Контекст 1

… таким образом, развили способность заглушать и реактивировать свой инфекционный цикл в ответ на давление иммунной системы. После первичного заражения HV переходят в квазиколичественное состояние, называемое латентным, при котором вирусный геном, как правило, замалчивается, но при этом возможны спорадические периоды реактивации (рис. 1)….

Контекст 2

… повсеместный гликопротеин типа I CD46, белок, экспрессируемый на поверхности всех ядерных клеток, опосредует проникновение в клетки HHV-6, взаимодействуя с вирусными гликопротеинами G, H и L (Санторо и др., 1999; Мори и др., 2003). После связывания с рецептором включение HV в клетки-мишени осуществляется гликопротеинами оболочки, которые способствуют слиянию между вирусной и клеточной мембранами (Figure 1a, b) (Radtke et al., 2006). …

Контекст 3

… Слияние с клеткой-хозяином, развившаяся оболочка HV высвобождает свою вирусную ДНК в ядро, где она циркулирует до того, как происходит транскрипция и репликация вирусной ДНК (рис. 1c, d). Продуктивная инфекция HV характеризуется последовательной экспрессией трех подмножеств литических генов через клеточную РНК-полимеразу II (рис. 1e, f, h) (обзор у Boehmer and Nimonkar, 2003). …

Контекст 4

… слияние с клеткой-хозяином, развернувшаяся HV высвобождает свою вирусную ДНК в ядро, где она циркулирует до того, как произойдет транскрипция и репликация вирусной ДНК (рис. 1c, d ).Продуктивная инфекция HV характеризуется последовательной экспрессией трех подмножеств литических генов через клеточную РНК-полимеразу II (рис. 1e, f, h) (обзор у Boehmer and Nimonkar, 2003). …

Контекст 5

… генные продукты функционируют в первую очередь, чтобы инициировать вирусную репродукцию, активируя экспрессию раннего (E) и позднего (L) наборов генов, в то время как гены E способствуют метаболизму нуклеиновых кислот, способствуют распространению вирусов. Синтез ДНК и может выполнять иммуномодулирующие функции для повышения выживаемости вирусов (Fox et al., 2017; Nishimura et al., 2017). В свою очередь, структурные единицы новых вирионов HV, кодируемые генами L, экспрессируются только после репликации вирусного генома (рис. 1g, h). Недавно синтезированная вирусная ДНК и структурные белки затем собираются в капсиды, которые пересекают сеть транс-Гольджи для приобретения вирусных гликопротеинов, прежде чем они высвобождаются из клетки посредством экзоцитоза (рис. 1i-k) (Smith, 2012; Agut et al., 2015). …

Контекст 6

… в свою очередь, структурные единицы новых вирионов HV, кодируемые генами L, экспрессируются только после репликации вирусного генома (рис. 1g, h).Недавно синтезированная вирусная ДНК и структурные белки затем собираются в капсиды, которые пересекают сеть транс-Гольджи для приобретения вирусных гликопротеинов, прежде чем они высвобождаются из клетки посредством экзоцитоза (рис. 1i-k) (Smith, 2012; Agut et al., 2015). Хотя продуктивная инфекция многими вирусами вызывает прямой лизис клеток, HV способны отделяться от клетки-хозяина без разрыва плазматической мембраны. …

Контекст 7

… любые очевидные симптомы (Pantry et al., 2013; Menendez et al., 2016). Скрытая ДНК HV, как канонически известно, принимает форму кольцевой эписомы внутри ядра (рис. 1.1). Это верно для HSV-1, геном которого ассоциирован с коровыми гистонами (Deshmane and Fraser, 1989). …

Контекст 8

… верно для HSV-1, геном которого ассоциирован с коровыми гистонами (Deshmane and Fraser, 1989). HHV-6, однако, уникален тем, что устанавливает латентный период путем прямой интеграции в ДНК хозяина (рис. 1.1).Это вероятно связано с событиями гомологичной рекомбинации между теломерами хозяина и совершенными теломерными повторами, обнаруженными на периферии генома HHV-6 (Arbuckle et al., 2010). …

Контекст 9

… того, как устанавливается задержка, отличительной чертой латентности как при инфекциях HSV-1, так и при HHV-6 является выражение продуктов генов, связанных с задержкой (рис. 1m). Транскрипт, связанный с латентностью HSV-1 (LAT), и несколько вирусных miRNA участвуют в обеспечении выживания клетки-хозяина и нацеливании вирусных трансактиваторов на деградацию для сохранения латентности (Thompson and Sawtell, 2001; Umbach et al., 2008). …

Контекст 10

… латентность сохраняет спящие HV в хосте на протяжении всей жизни, и HSV- и HHV-6 сохраняют способность «просыпаться» и производить инфекционные вирионы (Рисунок 1n) ( Owens et al., 2011; Bennett et al., 2012). Этот процесс, называемый реактивацией, может происходить, когда иммунная система хозяина ослаблена или нарушена.

Добавить комментарий

Ваш адрес email не будет опубликован.